DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG11037

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:224 Identity:75/224 - (33%)
Similarity:109/224 - (48%) Gaps:17/224 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SPQE-RIVGG-VEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCV---QYPDSYSVRAGS 79
            ||.| |::|| |.....|..:|.::....::.|...|:....::||.||.   .....:.|.||.
  Fly    56 SPHETRVIGGHVTTNAKLGGYLTALLYEDDFVCGGTLLNENIVLTAAHCFLGRMKASEWIVAAGI 120

  Fly    80 TFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLD---KSFTLGGNIQVVKLPLPSLNILPRT- 140
            :..:..|.||:|...||...|....:..|:|::.|.   |:..:|      .|.|.|:::.|.. 
  Fly   121 SNLNQKGIRRHVKDFILSEQFREDDMNMDVAVVLLKTPLKAKNIG------TLSLCSVSLKPGVE 179

  Fly   141 LLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCAAGAGR-DHCYGDSG 204
            |:|:|||............||...|.:|:::.|:..|....: |||.|:|||..|| |.|..|||
  Fly   180 LVVSGWGMTAPRGRGPHNLLRTVTVPIIHKKNCRAAYQPTAK-ITDSMICAAVLGRKDACTFDSG 243

  Fly   205 APLVHRGSSYGIVSFAHGCADPHFPGVYT 233
            .|||.:....|||||..|||...:|||||
  Fly   244 GPLVFKKQVCGIVSFGIGCASNRYPGVYT 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 72/219 (33%)
Tryp_SPc 25..242 CDD:238113 71/218 (33%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 72/219 (33%)
Tryp_SPc 62..283 CDD:238113 71/218 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455699
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.