DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and Sems

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:226 Identity:82/226 - (36%)
Similarity:117/226 - (51%) Gaps:15/226 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QERIVGG-VEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQ---YPDSYSVRAGSTFT 82
            |.|::|| |.....|..:|.::....|:.|...||..|.::||.||.:   ..:::||..|.:..
  Fly    41 QTRVIGGRVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGISRL 105

  Fly    83 DGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPLPSLNILP-RTLLVAGW 146
            ...|.||.|...|....|.:.|:..|:|::.|::.. :|.||..  |.|.|..:.| :|:.|:||
  Fly   106 SEKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPM-VGKNIGT--LSLCSTALTPGQTMDVSGW 167

  Fly   147 G--NPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCAAGAG-RDHCYGDSGAPLV 208
            |  |||  |......||...|.||.:|:|:..|.. ...|:|.|.||:..| :|.|..|||.|||
  Fly   168 GMTNPD--DEGPGHMLRTVSVPVIEKRICREAYRE-SVSISDSMFCASVLGKKDACTYDSGGPLV 229

  Fly   209 HRGSSYGIVSFAHGCADPHFPGVYTRLANYV 239
            :.....|||||..|||...:|||||.: :||
  Fly   230 YEKQVCGIVSFGIGCASRRYPGVYTDV-HYV 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 81/224 (36%)
Tryp_SPc 25..242 CDD:238113 80/223 (36%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 81/224 (36%)
Tryp_SPc 44..265 CDD:238113 80/223 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455706
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.