DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and PRSS57

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_999875.2 Gene:PRSS57 / 400668 HGNCID:31397 Length:283 Species:Homo sapiens


Alignment Length:264 Identity:87/264 - (32%)
Similarity:133/264 - (50%) Gaps:33/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILALILLLICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCV 67
            :|.:...|:...|..|.|...:|:||.||..|..|::||:...|.:.|...|:.:.|:|:|.||.
Human    12 LLTVATALMLPVKPPAGSWGAQIIGGHEVTPHSRPYMASVRFGGQHHCGGFLLRARWVVSAAHCF 76

  Fly    68 QYPDSYSVRAG---------STFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGN 123
            .:.|   :|.|         || .:...|...:.::..|||::..|..|||.||:|:.|..||..
Human    77 SHRD---LRTGLVVLGAHVLST-AEPTQQVFGIDALTTHPDYHPMTHANDICLLRLNGSAVLGPA 137

  Fly   124 IQVVKLPLPSLNILPRT----LLVAGWGNPDATD-SESEPRLRGTVVKVINQRLCQRLY-SHLHR 182
            :.::: | |.....|.|    ..|||||  ..:| .|..|.|....|:|::..:|...: .||  
Human   138 VGLLR-P-PGRRARPPTAGTRCRVAGWG--FVSDFEELPPGLMEAKVRVLDPDVCNSSWKGHL-- 196

  Fly   183 PITDDMVCAAGAGRDH----CYGDSGAPLVHRGSSYGIVSFAH-GCADPHFPGVYTRLANYVTWI 242
              |..|:|.. :|..|    |..|||.|||.|..::|:|||:. .|.||..|.|||:::.:|.||
Human   197 --TLTMLCTR-SGDSHRRGFCSADSGGPLVCRNRAHGLVSFSGLWCGDPKTPDVYTQVSAFVAWI 258

  Fly   243 FNVL 246
            ::|:
Human   259 WDVV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 79/237 (33%)
Tryp_SPc 25..242 CDD:238113 79/236 (33%)
PRSS57NP_999875.2 Tryp_SPc 34..258 CDD:238113 79/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D526726at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R11227
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.