DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG10663

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:272 Identity:87/272 - (31%)
Similarity:129/272 - (47%) Gaps:34/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLICGHKTS-----ALSPQERIVGGVEVPIHLTPW-LASITVHGNYSCSSALITSLWLVTAGHC 66
            |.|.||...|     ::|...:|:||........|| :|.:.......|...||...|::||.||
  Fly   485 LKLSCGIVRSGTGRRSMSNMLKIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHC 549

  Fly    67 VQYPDSYSVRAGS---TFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVK 128
            |:  ....||.|.   .:.||...:..|:....||:|:.||:::|:|||:|.|:......|....
  Fly   550 VR--KVLFVRIGEHNLNYEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSC 612

  Fly   129 LPLPSLNILPRTL--LVAGWG---NPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDM 188
            ||.| ...||:.:  .:.|||   |.|||.:..   |....|.:|..:.|:::|  ....||.:|
  Fly   613 LPQP-FQALPKNVDCTIIGWGKRRNRDATGTSV---LHKATVPIIPMQNCRKVY--YDYTITKNM 671

  Fly   189 VCAAGAGRDH---CYGDSGAPLV--------HRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWI 242
            .| ||..:.|   |.||||.||:        |..:.:||.||..|||..:..|:|.::.|||.|:
  Fly   672 FC-AGHQKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWV 735

  Fly   243 FNVLENDRKINM 254
            ::|:..|....|
  Fly   736 WSVVNCDGNCKM 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 77/237 (32%)
Tryp_SPc 25..242 CDD:238113 77/236 (33%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 77/237 (32%)
Tryp_SPc 507..735 CDD:238113 77/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455724
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.