DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG32271

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:254 Identity:86/254 - (33%)
Similarity:126/254 - (49%) Gaps:14/254 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LALILLLICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQ 68
            |.|.|:.:|.  .::.....||||||.|.|...|:|.::.:.||:.|..:|:|...:|||.|||:
  Fly     6 LVLHLIPLCW--AASNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVK 68

  Fly    69 --YPDSYSVRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPL 131
              ......|.||.|.....|.|..|..|.....:|.|||.:|:|:||| |:...|..:..::|..
  Fly    69 GIGASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKL-KAPISGPKVSTIELCN 132

  Fly   132 PSLNILPRTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCAAGAG- 195
            .|.. ....:.|:|||.....:.....::|...|.:|.::.|...|. |...||:.|.||:..| 
  Fly   133 TSFK-AGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYK-LRGTITNTMFCASVPGV 195

  Fly   196 RDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIFNVLENDRKINM 254
            :|.|.||||.|.|::|...||||:..|||....|||||.:....::|      |:.:.|
  Fly   196 KDACEGDSGGPAVYQGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFI------DKALGM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 79/220 (36%)
Tryp_SPc 25..242 CDD:238113 78/219 (36%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 79/220 (36%)
Tryp_SPc 25..244 CDD:238113 79/227 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455709
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.