DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG13430

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:261 Identity:98/261 - (37%)
Similarity:138/261 - (52%) Gaps:21/261 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LALILLLICGHKTSA------LSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVT 62
            ||:.|.|||   |||      :....|||||.|..|...|...|:.:...::|...:|:...::|
  Fly     8 LAVALWLIC---TSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILT 69

  Fly    63 AGHCV-QY--PDSYSVRAGSTFTDGGGQRRNVVSVILHPDFNLRT-LENDIALLKLDKSFTLGGN 123
            |.||| :|  |..|.:||||:....||....|..:|.||:|:..| :.||||:::|.:......:
  Fly    70 AAHCVLEYSKPQYYVIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQD 134

  Fly   124 IQVVKLPLPSLNILPRT-LLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDD 187
            |:.:.|......|:|.. |.|:|||:...:..:.|.|||.|||.:.:|..|.|.|... ..:|:.
  Fly   135 IRPISLATSKDIIMPTAQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGA-GTVTNT 198

  Fly   188 MVCAA--GAGRDHCYGDSGAPLV----HRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIFNVL 246
            |.||.  ..|||.|.||||.|||    .|...|||||:..|||:..|||:||:::.|..||...:
  Fly   199 MFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTI 263

  Fly   247 E 247
            |
  Fly   264 E 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 86/228 (38%)
Tryp_SPc 25..242 CDD:238113 85/227 (37%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 86/228 (38%)
Tryp_SPc 32..262 CDD:238113 87/230 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.