DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG32269

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:244 Identity:90/244 - (36%)
Similarity:134/244 - (54%) Gaps:15/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HKTSALSP--QERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQ-YPDS-YS 74
            :|.:|.|.  |.|||||....|..||::..:. .|:..||.:|||..|::||.|||: |..| ::
  Fly    96 NKKAATSSKIQSRIVGGTSTTISTTPYIVQLR-RGSNLCSGSLITEQWVLTAAHCVKGYSASDFT 159

  Fly    75 VRAGSTFTDGG-GQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPLPSLNILP 138
            ||.|:|..||. |..|:|.|:.:.|.|..:.:..|.|||||::|.| |.||..:.:.    |..|
  Fly   160 VRGGTTTLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLT-GTNIGTISMG----NYRP 219

  Fly   139 RT---LLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCAAGAGRDHCY 200
            :.   :.:||||......:.:...|:...::|:.|:.|::.|.. ...||..|:||..||:|.|.
  Fly   220 KAGSRVRIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRG-QATITKYMLCARAAGKDSCS 283

  Fly   201 GDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIFNVLEND 249
            ||||.|:....:..|||||.:|||...:|||||.:.....|..|::.|:
  Fly   284 GDSGGPVTRNNTLLGIVSFGYGCARAGYPGVYTAVVAIRQWATNIMANN 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 83/223 (37%)
Tryp_SPc 25..242 CDD:238113 82/222 (37%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 83/222 (37%)
Tryp_SPc 121..324 CDD:238113 76/209 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455695
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.