DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG32270

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:240 Identity:79/240 - (32%)
Similarity:120/240 - (50%) Gaps:33/240 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQ--YPDSYSVRAGSTFT 82
            ||  |||||....:...|.:.:|...||:.|..:|:|...::||.||:.  .|..:.||.|.|:.
  Fly    28 SP--RIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTYL 90

  Fly    83 DGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPLPSLNILPRTLL----- 142
            ......|.|..:::...::..||::|:|||:|             |.||.:....|.:|.     
  Fly    91 SDMRNSRYVRKILMPSAYSRTTLDHDVALLQL-------------KQPLQASIAKPISLAVRSPR 142

  Fly   143 ------VAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCAAGAG-RDHCY 200
                  |:|||..|::.:....:|:...|:|:.||.|:.||.. :|.||..|.||:..| :|.|.
  Fly   143 PGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRG-YRNITSSMFCASVPGLKDACA 206

  Fly   201 GDSGAPLVH-RGSSYGIVSF--AHGCADPHFPGVYTRLANYVTWI 242
            ||||.|:|: .|...|:||:  ||.||....||||:.::....||
  Fly   207 GDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 75/234 (32%)
Tryp_SPc 25..242 CDD:238113 74/233 (32%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 75/234 (32%)
Tryp_SPc 31..254 CDD:238113 76/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455697
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.