DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG32833

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:238 Identity:68/238 - (28%)
Similarity:108/238 - (45%) Gaps:30/238 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQYPDSY-----SVRAGSTFTDGG 85
            :||..|.|...||:|||::.....|..|:.....:||||.||   |.:     .||.|||....|
  Fly    39 LGGHPVNITTAPWIASISIKQKAKCDGAIYKLSHIVTAGKCV---DGFLNKVIRVRVGSTTRSDG 100

  Fly    86 GQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPLPSLNILPRT---LLVAGWG 147
            .....|.::.:|..|..:|:.:::|:|||.:.......||    |:...|.||..   :...||.
  Fly   101 VIEVAVCNITVHEKFTGQTVFHNVAILKLCEPLEASKTIQ----PIQLANQLPSNGAKVTANGWP 161

  Fly   148 N--------PDATDSESEPRLRGTVVKVINQRLCQRLYSHLH---RPITDDMVCAAGAGRDHCYG 201
            :        ....|.|:. :|:...||::....|..|::..:   :..|||:.|.....::.|..
  Fly   162 SFRWWAMYWKKCLDDEAY-KLQKAEVKLLGPSQCTDLWARNNWSKKNFTDDLFCTEKFAKEACSL 225

  Fly   202 DSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIFN 244
            ..|:|:||.|...||:: ..||::  :|.||..|..|..|:.|
  Fly   226 AMGSPVVHNGKLVGIIT-KGGCSE--YPEVYINLIKYKDWLHN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 66/234 (28%)
Tryp_SPc 25..242 CDD:238113 66/234 (28%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 68/237 (29%)
Tryp_SPc 40..262 CDD:214473 66/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.