DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and thetaTry

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:264 Identity:85/264 - (32%)
Similarity:128/264 - (48%) Gaps:29/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LILLLICGHKTSALS---------PQE---RIVGGVEVPIHLTPWLASI-TVHGNYSCSSALITS 57
            |::||:|....||.:         |.|   |||||.:..|...|:..|: |..|::.|..:||..
  Fly     4 LVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINE 68

  Fly    58 LWLVTAGHCV--QYPDSYSVRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTL 120
            ..:|||.||:  :......||.|||..:.||....|..:..:.|:|.:|:|.|:.:||||:....
  Fly    69 DTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILKLDEKVKE 133

  Fly   121 GGNIQVVKLPLPSLNILP---RTLLVAGWGNPDATDSESEPR-LRGTVVKVINQRLC---QRLYS 178
            ..||:.::|...:    |   .|.:|.|||:.......:.|: |:...|.:::.:.|   :..|.
  Fly   134 TENIRYIELATET----PPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYKYG 194

  Fly   179 HLHRPITDDMVCAAGAGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIF 243
            .:   |.|.||||....:|.|.||||.||....:..||||:.:.||....||||:.:.....||.
  Fly   195 EI---IYDSMVCAYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWIL 256

  Fly   244 NVLE 247
            |..|
  Fly   257 NASE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 73/227 (32%)
Tryp_SPc 25..242 CDD:238113 72/226 (32%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 73/227 (32%)
Tryp_SPc 35..255 CDD:238113 72/226 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.