DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and etaTry

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:263 Identity:83/263 - (31%)
Similarity:131/263 - (49%) Gaps:35/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNILALILLLICGHKTSALSPQE--RIVGGVEVPIHLTPWLASITVHGNYS------CSSALITS 57
            :.|||::.||    ...|:|.|.  |||||.:...:.|.::..:....:.|      |...::.:
  Fly     6 LRILAVLFLL----GIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDA 66

  Fly    58 LWLVTAGHCV--QYPDSYSVRAGSTFTDGGGQRRNVV----SVILHPDFNLRTLENDIALLKLD- 115
            :.:.||.|||  :..:::.|.||.   |..|....||    .:|.|..:|..|::|||||:.:| 
  Fly    67 VTIATAAHCVYNREAENFLVVAGD---DSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDP 128

  Fly   116 ----KSFTLGGNIQVVKLPLPSLNILPRTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRL 176
                .||:....|::.. ..|::.:   ...::|||........|: :|:...|.:::...||..
  Fly   129 PLPLDSFSTMEAIEIAS-EQPAVGV---QATISGWGYTKENGLSSD-QLQQVKVPIVDSEKCQEA 188

  Fly   177 YSHLHRPITDDMVCA--AGAGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYV 239
            |  ..|||::.|:||  :..|:|.|.||||.|||......||||:..|||.|::||||..:|.|.
  Fly   189 Y--YWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYK 251

  Fly   240 TWI 242
            .||
  Fly   252 DWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 73/236 (31%)
Tryp_SPc 25..242 CDD:238113 72/235 (31%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 73/236 (31%)
Tryp_SPc 28..257 CDD:238113 74/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455702
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.