DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and kappaTry

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_610674.5 Gene:kappaTry / 36215 FlyBaseID:FBgn0043471 Length:263 Species:Drosophila melanogaster


Alignment Length:264 Identity:80/264 - (30%)
Similarity:127/264 - (48%) Gaps:43/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILLLICGHKTSALS----PQERIVGGVEVPIHLTPWLASITVHGN------YSCSSALITSLWLV 61
            :|||..|. :|.:|    |:.||:.|..|.|...|:|.|:....:      :.|:..:|:...|:
  Fly     5 LLLLAIGF-SSVISISGQPEGRIINGTTVDIARHPYLVSLRYRRDNESSYMHECAGVIISEQALI 68

  Fly    62 TAGHCVQ-YPDSYSVRAGSTFTDGGGQRRN--------VVSVILHPDFNLRTLENDIALLKLDKS 117
            |:..|:. .|:...:.|.:     |...||        |.:...||:::..|::|||.:|.||.:
  Fly    69 TSAQCLYGLPEETKLVAVA-----GANTRNGTDGFIYPVANWTHHPNYDPVTVDNDIGVLLLDTT 128

  Fly   118 FTLGGNIQVVKLPLPSLNILP------RTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRL 176
                  :.:..|.:.|:.|.|      |...|||||..:.. ..|..:|..|.|.|::...|.::
  Fly   129 ------LDLTLLGISSIGIRPERPAVGRLATVAGWGYREEW-GPSSYKLEQTEVPVVSSEQCTQI 186

  Fly   177 YSHLHRPITDDMVCA---AGAGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANY 238
            |.  ...:|:.|:||   ...|.|.|.||:|.|||..|...|:||:..|||.|::|.||..:|::
  Fly   187 YG--AGEVTERMICAGFVVQGGSDACQGDTGGPLVIDGQLVGLVSWGRGCARPNYPTVYCYVASF 249

  Fly   239 VTWI 242
            |.||
  Fly   250 VDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 71/241 (29%)
Tryp_SPc 25..242 CDD:238113 70/240 (29%)
kappaTryNP_610674.5 Tryp_SPc 25..253 CDD:214473 71/241 (29%)
Tryp_SPc 26..256 CDD:238113 72/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.