DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG17571

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:256 Identity:82/256 - (32%)
Similarity:129/256 - (50%) Gaps:12/256 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNILALILLLICGHKTSALS-PQERIVGGVEVPIHLTPWLASI-TVHGNYSCSSALITSLWLVTA 63
            ::::||:.|....|....|. |..|||.|.:|.|...|:..|: |..|::.|..:||.|..::||
  Fly     6 LSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTA 70

  Fly    64 GHCVQYPDSYS-----VRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGN 123
            .||:|   ||:     ||.|||....||:...|.:...|..:|.:.:.||:|::||.........
  Fly    71 AHCMQ---SYAASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPVRQTSK 132

  Fly   124 IQVVKLPLPSLNILPRTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQR-LYSHLHRPITDD 187
            |:.::| ..|..:.....:|:|||........|...|:...|.:::.:.|.. .|::....|.:.
  Fly   133 IRAIEL-ADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDSILET 196

  Fly   188 MVCAAGAGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIFNVLEN 248
            ||||.|..:|.|.||||.|||......|:||:..|||...:||||..:|:..:||.:..::
  Fly   197 MVCATGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWIVDTTDS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 74/224 (33%)
Tryp_SPc 25..242 CDD:238113 73/223 (33%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 74/224 (33%)
Tryp_SPc 31..254 CDD:238113 75/226 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.