DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and Send2

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:251 Identity:80/251 - (31%)
Similarity:118/251 - (47%) Gaps:26/251 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLICGHKTSA---LSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQY 69
            |||:..:..||   :.|:|||:||..:.|...||..||...|.:.|..::.::..::||.|||| 
  Fly     7 LLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAHCVQ- 70

  Fly    70 PDSYSVRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPLPSL 134
            ...|.|||||...:..|...:|.::..|     ..|.||||:::|.|.......:|  .:||...
  Fly    71 GQGYQVRAGSALKNSNGSVVDVAAIRTH-----EGLGNDIAIVRLSKPLEFTNQVQ--PIPLAKT 128

  Fly   135 NILPRTL-LVAGWGNPDATDSESEP-RLRGTVVKVINQRLCQRLYSHLHRPITDDMVCAAGAGRD 197
            |..|.:: .|:|||   ::...|.| .|:|     :|..:....|..|..|   ..:||...||.
  Fly   129 NPPPGSIAFVSGWG---SSSYYSHPIDLQG-----VNLYIQWPYYCGLTEP---SRICAGSFGRA 182

  Fly   198 HCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIFNVLENDRKIN 253
            .|.||||.|||......|:||  .|..|..:..:||.:..:..||.|.::.....|
  Fly   183 ACKGDSGGPLVFDQQLVGVVS--GGTKDCTYSSIYTSVPYFREWILNAIDEIMSAN 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 69/219 (32%)
Tryp_SPc 25..242 CDD:238113 68/218 (31%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 69/219 (32%)
Tryp_SPc 27..225 CDD:238113 68/218 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.