DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG1304

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:253 Identity:69/253 - (27%)
Similarity:111/253 - (43%) Gaps:25/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LILLLICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQYP 70
            |:||.:..|.... |...|:|||.:...:..|...|:...|::||..::::..:::||.|||...
  Fly    14 LLLLAVPVHSAPG-SLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQ 77

  Fly    71 DS-----------YSVRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNI 124
            ||           :::||||.....||....|..||:|.::.  ...||:|||:|:....|..:|
  Fly    78 DSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYG--NFLNDVALLRLESPLILSASI 140

  Fly   125 QVVKLPLPSLNILPR--TLLVAGWGNPDATDSESEPR-LRGTVVKVINQRLCQRLYSHLHRPITD 186
            |.:.||...   .|.  .::::|||.  .......|| |:...:|.|:...|..|   :...:..
  Fly   141 QPIDLPTAD---TPADVDVIISGWGR--IKHQGDLPRYLQYNTLKSISLERCDEL---IGWGVQS 197

  Fly   187 DMVCAAGAGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIFN 244
            ::.....|....|.||||.|.|:.....|:..|........:|..|.|:..:..||.|
  Fly   198 ELCLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIKN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 61/231 (26%)
Tryp_SPc 25..242 CDD:238113 60/230 (26%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 61/231 (26%)
Tryp_SPc 32..256 CDD:238113 63/234 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.