DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and Ser6

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:268 Identity:72/268 - (26%)
Similarity:117/268 - (43%) Gaps:52/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILLLICGHKTSALSPQE--------RIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTA 63
            :.:|:|......:.|.:        |:|||.:...:..|...|:...|::||..:::|..:::||
  Fly     6 VAILLCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTA 70

  Fly    64 GHCVQYPD-----------SYSVRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKS 117
            .|||...|           .:::||||.....||....|..||:|.::.  ...||:|||:|:..
  Fly    71 AHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYG--NFLNDVALLRLESP 133

  Fly   118 FTLGGNIQVVKLP---LPSLNILPRTLLVAGWGNPDATDSESEPR-LRGTVVKVINQRLCQRLYS 178
            ..|..:||.:.||   .|:    ...::::|||.  .......|| |:...:|.|.::.|:.|..
  Fly   134 LILSASIQPIDLPTVDTPA----DVDVVISGWGR--IKHQGDLPRYLQYNTLKSITRQQCEELID 192

  Fly   179 H--------LHRPITDDMVCAAGAGRDHCYGDSGAPLVHRGSSYGIVSF-AHGCADPHFPGVYTR 234
            .        ||:  .|:     ||    |.||||.|.|:.....|:..| ..||... :|..|.|
  Fly   193 FGFEGELCLLHQ--VDN-----GA----CNGDSGGPAVYNNQLVGVAGFVVDGCGST-YPDGYAR 245

  Fly   235 LANYVTWI 242
            :..:..||
  Fly   246 VFYFKDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 67/241 (28%)
Tryp_SPc 25..242 CDD:238113 66/240 (28%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 67/241 (28%)
Tryp_SPc 32..256 CDD:238113 68/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.