DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and Prss53

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:254 Identity:72/254 - (28%)
Similarity:114/254 - (44%) Gaps:36/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CGHK-TSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQYP----- 70
            ||.: .....|||    |..:|.. .||.||:...|.:.||.:|:...|::||.||.:..     
Mouse    28 CGQRGPGPPEPQE----GNTLPGE-WPWQASVRRQGVHICSGSLVADTWVLTAAHCFEKMATAEL 87

  Fly    71 DSYSVRAGSTFTDG---GGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQ-VVKLPL 131
            .|:||..||...:|   |.:...|.::.|...:|..:..:|:|||:|...     .:| .:.||.
Mouse    88 SSWSVVLGSLKQEGQSPGAEEVGVAALQLPKAYNHYSQGSDLALLQLTHP-----TVQTTLCLPQ 147

  Fly   132 PSLNI-LPRTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHR-----PITDDMVC 190
            |:.:. ...:....||   |...|:....||...:::|::..|..||:.||:     |....|:|
Mouse   148 PTYHFPFGASCWATGW---DQNTSDVSRTLRNLRLRLISRPTCNCLYNRLHQRLLSNPARPGMLC 209

  Fly   191 --AAGAGRDHCYGDSGAPLVHRGS-----SYGIVSFAHGCADPHFPGVYTRLANYVTWI 242
              |....:..|.||||.|::.|..     ..||:||...||....|.:.|.:|.:.:|:
Mouse   210 GGAQPGEQGPCQGDSGGPVMCREPDGHWVQVGIISFTSKCAQEDTPVLLTDMAVHSSWL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 66/239 (28%)
Tryp_SPc 25..242 CDD:238113 66/238 (28%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46 6/21 (29%)
Tryp_SPc 45..271 CDD:238113 66/233 (28%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.