DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG4653

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:262 Identity:74/262 - (28%)
Similarity:115/262 - (43%) Gaps:46/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILALILLLICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCV 67
            :|.|::::..|...|:..|.|  ||.       .|...|:..:|.:.|..|||...|::||.|||
  Fly    12 LLLLVVIVTLGVVQSSRLPAE--VGS-------QPHSISLRRNGVHVCGGALIREKWILTAAHCV 67

  Fly    68 -------QYP-DSYSVRAGSTFTDGGGQRRNVVSVILHPDFNLRTL--ENDIALLKLDKSFTLGG 122
                   .|| .||:||.||.....|||...:..:|:|.:::....  .||:|||:|:.|..|..
  Fly    68 SLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNA 132

  Fly   123 NIQVVKLPL--PSLNILPRTLLVAGWGNPDATDSESEPRLRGTVVKVINQRL-----CQ-RLYSH 179
            |...:.|..  |:..   ..::.:|||:.....|.|.      |::|..::.     || .||..
  Fly   133 NTNPIDLATERPAAG---SQIIFSGWGSSQVDGSLSH------VLQVATRQSLSASDCQTELYLQ 188

  Fly   180 LHRPITDDMVCAAGAGRDH---CYGDSGAPLVHRGSSYGIVS-FAHGCADPHFPGVYTRLANYVT 240
                 .:|::|.:....|.   |.||:|||..:.....||.: |..||.... |..|..:..::.
  Fly   189 -----QEDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSEQ-PDGYVDVTQHLE 247

  Fly   241 WI 242
            ||
  Fly   248 WI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 66/239 (28%)
Tryp_SPc 25..242 CDD:238113 66/238 (28%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 70/244 (29%)
Tryp_SPc 30..249 CDD:214473 68/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.