DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and sphe

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:250 Identity:72/250 - (28%)
Similarity:114/250 - (45%) Gaps:23/250 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILALILLLICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCV 67
            ||.||.|...|    ....|.||:||.:.....|.:.||:.|...:.|..::::...::|..|||
  Fly     8 ILGLIGLTAVG----MCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHCV 68

  Fly    68 QY------PDSYSVRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQV 126
            ..      ....:.|.|||....||:..||.||.:|||:  ..|.|::|::.|....|....|..
  Fly    69 HRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDY--YNLNNNLAVITLSSELTYTDRITA 131

  Fly   127 VKLPLPSLNILP---RTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDM 188
            :.| :.|...||   ..::|||||.  .:|..:..::|...:||..:..|...||. |   .:..
  Fly   132 IPL-VASGEALPAEGSEVIVAGWGR--TSDGTNSYKIRQISLKVAPEATCLDAYSD-H---DEQS 189

  Fly   189 VCAAGAGRD-HCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWI 242
            .|.|...:: .|:||.|...::..:..|:.:|..|.....:|.|:.||::|..||
  Fly   190 FCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 63/227 (28%)
Tryp_SPc 25..242 CDD:238113 62/226 (27%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 58/211 (27%)
Tryp_SPc 42..244 CDD:214473 57/210 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.