DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG33160

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:256 Identity:87/256 - (33%)
Similarity:133/256 - (51%) Gaps:17/256 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILALILLLICG-HKTSALSP-----QERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLV 61
            :.:|.|:.|.| |......|     |.||:||....|....:|..:|. ....|..:|:...|::
  Fly     6 LTSLFLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVTT-SEELCGGSLVKPRWVI 69

  Fly    62 TAGHCV--QYPDSYSVRAGSTFTDGG-GQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGN 123
            ||.|||  :..:.:.:..|::...|. ...|.|..:.:.||||.:||..|:|.|:|: |..:|.|
  Fly    70 TAAHCVYNKNKNDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLN-SDMIGAN 133

  Fly   124 IQVVKLPLPSLNILPRTLL-VAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDD 187
            |:.:  ||.:.::..|.|: |:|||...|..:::..|:...:|.:.::..|...:..:|| ||..
  Fly   134 IETI--PLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHR-ITRS 195

  Fly   188 MVCAAGA-GRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIFNVLE 247
            |||||.. .:|.|.||||.|||:||...|||||.:|||.. .||:||.:.....|...|:|
  Fly   196 MVCAARLYKKDSCDGDSGGPLVYRGQLAGIVSFGYGCASA-LPGIYTSVPEIRDWFQRVVE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 77/222 (35%)
Tryp_SPc 25..242 CDD:238113 76/221 (34%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 77/221 (35%)
Tryp_SPc 34..253 CDD:238113 77/224 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455700
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.