DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG6041

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:290 Identity:85/290 - (29%)
Similarity:125/290 - (43%) Gaps:47/290 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILALILLLICGHKTSALSP------QERIVGGVEVPIHLTPWLASITVHGN--------YSCSSA 53
            |||:.|.|.......:||.      :.:||||.:..|....:..||.:..|        :.|...
  Fly     7 ILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGV 71

  Fly    54 LITSLWLVTAGHCVQYPDSYSVRA--------GSTFTDGGGQRR---NVVSVILHPDFNLRTLEN 107
            :|:...:.||.||....|....|.        |||:......|.   .:..:|.|.::|...|.|
  Fly    72 VISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTN 136

  Fly   108 DIALLKLDKSFTLGGNI-----QVVKLPLPSLNILPRT-LLVAGWGNPDATDSESEPRLRGTVVK 166
            ||||:      .:.|.|     .|..|.|.|..:...| .|::|||......:.|...|:...|.
  Fly   137 DIALM------FINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVP 195

  Fly   167 VINQRLCQRLYSHLHRPITDDMVCAA--GAGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFP 229
            :::...|:..|:.:  |::  .|||.  ..|.|.|.||||.|:...|...||||:..|||.|.:|
  Fly   196 IVSYTTCRISYNSI--PVS--QVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYP 256

  Fly   230 GVYTRLANYVTWIFNVLENDRKINMT-YKN 258
            ||||.::.|..||   ::.:..:|.| |.|
  Fly   257 GVYTNVSYYYDWI---VQKNSSLNYTIYHN 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 72/244 (30%)
Tryp_SPc 25..242 CDD:238113 72/243 (30%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 72/244 (30%)
Tryp_SPc 35..272 CDD:238113 74/249 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455701
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.