DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CG3795

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:213 Identity:55/213 - (25%)
Similarity:96/213 - (45%) Gaps:27/213 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NYSCSSALITSLWLVTAGHCVQYPDSYSVRAGSTFTDGGGQRRNVVS----------VILHPDFN 101
            |:.|:..:.:...::||.||: :.:...::|.......|..||.:.|          ::.||.:.
  Fly    76 NHFCAGTIFSERAILTAAHCM-FSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEELLPHPKYK 139

  Fly   102 L-RTLENDIALLKLDKSFTLGGNIQVVKLPLPSLNILP---RTLLVAGWGNPDATDSESEPRLRG 162
            . ::.:.||.|:.|:...:||.  .|.|:||  .|.:|   ....:.|||.........:..:.|
  Fly   140 KGKSQKYDIGLILLEADLSLGD--AVAKIPL--YNKVPVAGAPCSIVGWGTVIQFGPLPDEAING 200

  Fly   163 TVVKVINQRLCQRLYSHLHRPITDDMVCA---AGAGRDHCYGDSGAPLVHRGSSYGIVSFAHGCA 224
            . ::::....|::|....:.    .|:||   ..:..|.|.||||.||:......|||||..||.
  Fly   201 D-MQILPDTFCEKLLGWSNA----GMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGMGCG 260

  Fly   225 DPHFPGVYTRLANYVTWI 242
            :|...|:||.:.::..||
  Fly   261 EPDSAGIYTDVYHFRDWI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 53/211 (25%)
Tryp_SPc 25..242 CDD:238113 53/211 (25%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 55/213 (26%)
Tryp_SPc 60..278 CDD:214473 53/211 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455705
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.