DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and GZMM

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_005308.2 Gene:GZMM / 3004 HGNCID:4712 Length:257 Species:Homo sapiens


Alignment Length:249 Identity:79/249 - (31%)
Similarity:122/249 - (48%) Gaps:14/249 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILLLICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCV-QYP 70
            :|:|..|..:...|...:|:||.||..|..|::||:..:|::.|...|:...|::||.||: |..
Human     8 LLVLALGALSVGSSFGTQIIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRM 72

  Fly    71 DSYSVRAGSTFTDGGGQRRNVVSVILHPDFN-LRTLENDIALLKLDKSFTLGGNIQVVKLPLPSL 134
            ....:..|....|..|...::.:.|.||.:. :..||||:|||:||........|:.:.||....
Human    73 AQLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQ 137

  Fly   135 NILPRT-LLVAGWGNPDATDSESEPRLRGTVVKVINQRLC--QRLYSHLHRPITDDMVCAAGAGR 196
            .:...| ..:||||........|.. ||...::|::.|:|  .|.:   :..::..|||.|...:
Human   138 VVAAGTRCSMAGWGLTHQGGRLSRV-LRELDLQVLDTRMCNNSRFW---NGSLSPSMVCLAADSK 198

  Fly   197 DH--CYGDSGAPLV-HRGSSYG-IVSF-AHGCADPHFPGVYTRLANYVTWIFNV 245
            |.  |.||||.||| .:|.... ::|| :..|.|...|.|.|.:|.||:||..|
Human   199 DQAPCKGDSGGPLVCGKGRVLARVLSFSSRVCTDIFKPPVATAVAPYVSWIRKV 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 72/227 (32%)
Tryp_SPc 25..242 CDD:238113 72/226 (32%)
GZMMNP_005308.2 Tryp_SPc 26..252 CDD:238113 74/229 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R11227
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.