DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and Klk1c10

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001128645.1 Gene:Klk1c10 / 292858 RGDID:1561403 Length:259 Species:Rattus norvegicus


Alignment Length:266 Identity:84/266 - (31%)
Similarity:124/266 - (46%) Gaps:25/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNILALILLLICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGH 65
            |..|.|.|.|..|...:|...|.|||||.:...:..||  .:.:...|.|...||...|::||.|
  Rat     1 MWFLILFLALSLGGIDAAPPGQSRIVGGYKCEKNSQPW--QVAIINEYLCGGVLIDPSWVITAAH 63

  Fly    66 CVQYPDSYSVRAG--STFTDGG-GQRRNVVSVILHPD---FNLRT--------LENDIALLKLDK 116
            |  |.:.|.|..|  :.|.|.. .|.|.|.....|||   |.:|.        ..||:.||.|.:
  Rat    64 C--YSNYYHVLLGRNNLFEDEPFAQYRFVNQSFPHPDYKPFLMRNHTRQRGDDYSNDLMLLHLSE 126

  Fly   117 SFTLGGNIQVVKLPLPSLNILPRTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLH 181
            ...:...::|:.||.....: ..|.|.:|||:....:.|....|:...:.:::...|...|   .
  Rat   127 PADITDGVKVIDLPTEEPKV-GSTCLASGWGSTKPLNWELPDDLQCVNIHLLSNEKCIEAY---E 187

  Fly   182 RPITDDMVCAA--GAGRDHCYGDSGAPLVHRGSSYGIVSFAH-GCADPHFPGVYTRLANYVTWIF 243
            :.:||.|:||.  ...:|.|.||||.||:..|...||.|:.: .||:|:.|||||:|..:.:||.
  Rat   188 QKVTDLMLCAGEMDGRKDTCKGDSGGPLICDGVLQGITSWGNVPCAEPYNPGVYTKLIKFTSWIK 252

  Fly   244 NVLEND 249
            .|::.:
  Rat   253 EVMKEN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 73/234 (31%)
Tryp_SPc 25..242 CDD:238113 72/233 (31%)
Klk1c10NP_001128645.1 Tryp_SPc 24..251 CDD:214473 73/234 (31%)
Tryp_SPc 25..254 CDD:238113 74/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.