DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and Klk10

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:268 Identity:75/268 - (27%)
Similarity:122/268 - (45%) Gaps:36/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNILALILLLICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGH 65
            |.:.|...||:.|:.|.    ::....|...|....||..|:..:..:.|:..|:...|::||.|
  Rat    27 MQLWAAQALLLPGNTTR----EDLEAFGTLCPSVSQPWQVSLFHNLQFQCAGVLVDQNWVLTAAH 87

  Fly    66 C-------VQYPDSYSVRAGSTFTDGGGQRRNVVSVILHPDFN--------LRTLENDIALLKLD 115
            |       .:..|.:.:...|.      |.|:..|.:.||.:.        ||:.|:|:.:|||.
  Rat    88 CWRNKPLRARVGDDHLLLFQSE------QLRSTNSPVFHPKYQPCSGPVLPLRSDEHDLMMLKLS 146

  Fly   116 KSFTLGGNIQVVKLPLPSLNILPR-TLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSH 179
            ....|...:..|:||.....  || ...|:|||.......:....|..:.|.:::|:.|:..|..
  Rat   147 SPVVLTSKVHPVQLPFQCAQ--PRQECQVSGWGTTANRRVKYNRSLSCSRVTLLSQKQCETFYPG 209

  Fly   180 LHRPITDDMVCAAGAGRDH--CYGDSGAPLVHRGSSYGIVSFA-HGC-ADPHFPGVYTRLANYVT 240
            :   ||::|:| ||..||.  |..|||.|||...:.:||:|:: :.| |...:|.||.::.||..
  Rat   210 V---ITNNMIC-AGMDRDQDSCQSDSGGPLVCDNTLHGILSWSIYPCGAATQYPAVYAKICNYTN 270

  Fly   241 WIFNVLEN 248
            ||..|:.:
  Rat   271 WIRRVIRS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 66/237 (28%)
Tryp_SPc 25..242 CDD:238113 66/236 (28%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 66/233 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.