DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and LOC286960

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:236 Identity:80/236 - (33%)
Similarity:119/236 - (50%) Gaps:11/236 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQYPDSYSVRAGS---T 80
            ::..::||||...|.||.|:..|:....::.|..:||:..|:::|.||  |.....||.|.   .
  Rat    18 VNDDDKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHC--YKRKLQVRLGEHNIH 80

  Fly    81 FTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPLPSLNILPRTLLVAG 145
            ..:||.|..:...:|.||::|..||:|||.|:||.....|...:..|.|| .|........||:|
  Rat    81 VLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLP-RSCASTDAQCLVSG 144

  Fly   146 WGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCAA--GAGRDHCYGDSGAPLV 208
            |||..:...:....|:.....|::...|::.|.   ..||.:|.|..  ..|:|.|.||||.|:|
  Rat   145 WGNTVSIGGKYPALLQCLEAPVLSASSCKKSYP---GQITSNMFCLGFLEGGKDSCDGDSGGPVV 206

  Fly   209 HRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIFNVLEND 249
            ..|...||||:...||....|||||::.||::||...:.|:
  Rat   207 CNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETMANN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 77/222 (35%)
Tryp_SPc 25..242 CDD:238113 77/221 (35%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 77/222 (35%)
Tryp_SPc 24..243 CDD:238113 79/224 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.