DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and Prss1

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_036767.1 Gene:Prss1 / 24691 RGDID:3417 Length:246 Species:Rattus norvegicus


Alignment Length:245 Identity:88/245 - (35%)
Similarity:124/245 - (50%) Gaps:15/245 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ALILLLICGHKTS-ALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQ 68
            ||::|.:.|...: .|...::||||...|.|..|:..|:. .|.:.|..:||...|:|:|.||  
  Rat     3 ALLILALVGAAVAFPLEDDDKIVGGYTCPEHSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHC-- 64

  Fly    69 YPDSYSVRAGS---TFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLP 130
            |.....||.|.   ...:|..|..|...:|.||:::..||.|||.|:||.....|  |.:|..:.
  Rat    65 YKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKL--NARVAPVA 127

  Fly   131 LPSLNILPRT-LLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCAA-- 192
            |||......| .|::||||..:....:...|:.....|::|..|:..|.   ..||..|:|..  
  Rat   128 LPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYP---GEITSSMICVGFL 189

  Fly   193 GAGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWI 242
            ..|:|.|.||||.|:|..|...||||:.:|||.|..|||||::.|:|.||
  Rat   190 EGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 81/223 (36%)
Tryp_SPc 25..242 CDD:238113 81/222 (36%)
Prss1NP_036767.1 Tryp_SPc 23..239 CDD:214473 81/223 (36%)
Tryp_SPc 24..242 CDD:238113 83/224 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.