DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and Try4

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_035776.1 Gene:Try4 / 22074 MGIID:102757 Length:246 Species:Mus musculus


Alignment Length:256 Identity:89/256 - (34%)
Similarity:122/256 - (47%) Gaps:29/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ALILLLICGHKTS-ALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQ 68
            ||:.|.:.|...: .:...::||||.....:..|:..|:. .|.:.|..:||...|:|:|.||  
Mouse     3 ALLFLALVGAAVAFPVDDDDKIVGGYTCRENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHC-- 64

  Fly    69 YPDSYSVRAGS---TFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLP 130
            |.....||.|.   ...:|..|..|...:|.||:||.|||.|||.|:||....||...:..|.||
Mouse    65 YKSRIQVRLGEHNINVLEGNEQFVNSAKIIKHPNFNSRTLNNDIMLIKLASPVTLNARVATVALP 129

  Fly   131 LPSLNILPRTLLVAGWG--------NPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDD 187
             .|........|::|||        |||.......|        ::.|..|:..|.   ..||::
Mouse   130 -SSCAPAGTQCLISGWGNTLSFGVNNPDLLQCLDAP--------LLPQADCEASYP---GKITNN 182

  Fly   188 MVCAA--GAGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIFNVL 246
            |:|..  ..|:|.|.||||.|:|..|...||||:.:|||....|||||::.|||.||.|.:
Mouse   183 MICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQNTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 82/230 (36%)
Tryp_SPc 25..242 CDD:238113 82/229 (36%)
Try4NP_035776.1 Tryp_SPc 23..239 CDD:214473 82/230 (36%)
Tryp_SPc 24..242 CDD:238113 84/232 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.