DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and Prss3

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_035775.1 Gene:Prss3 / 22073 MGIID:102758 Length:246 Species:Mus musculus


Alignment Length:248 Identity:94/248 - (37%)
Similarity:124/248 - (50%) Gaps:15/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNILALILLLICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGH 65
            ||.| |||.|:.......:...::||||.....:..|:..|:. .|.:.|..:||...|:|:|.|
Mouse     1 MNAL-LILALVGAAVAFPVDDDDKIVGGYTCQENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAH 63

  Fly    66 CVQYPDSYSVRAGS---TFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVV 127
            |  |.....||.|.   ...:|..|..|...:|.||:||.:||.|||.||||....||...:..|
Mouse    64 C--YKTRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFNRKTLNNDIMLLKLSSPVTLNARVATV 126

  Fly   128 KLPLPSLNILPRTLLVAGWGNPDATDSESEPRLRGTV-VKVINQRLCQRLYSHLHRPITDDMVCA 191
            .|| .|........|::|||| ..:...|||.|...: ..::.|..|:..|.   ..||.:||||
Mouse   127 ALP-SSCAPAGTQCLISGWGN-TLSFGVSEPDLLQCLDAPLLPQADCEASYP---GKITGNMVCA 186

  Fly   192 A--GAGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWI 242
            .  ..|:|.|.||||.|:|......||||:.:|||.|..|||||::.|||.||
Mouse   187 GFLEGGKDSCQGDSGGPVVCNRELQGIVSWGYGCALPDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 85/223 (38%)
Tryp_SPc 25..242 CDD:238113 85/222 (38%)
Prss3NP_035775.1 Tryp_SPc 23..239 CDD:214473 85/223 (38%)
Tryp_SPc 24..242 CDD:238113 87/224 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.