DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and Gzmm

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_032530.1 Gene:Gzmm / 16904 MGIID:99549 Length:264 Species:Mus musculus


Alignment Length:272 Identity:79/272 - (29%)
Similarity:125/272 - (45%) Gaps:54/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILALILLLICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCV 67
            :|||..|...|::.     :.:|:||.|...|..|::||:....::.|...|:...|::||.||:
Mouse    10 LLALKTLWAAGNRF-----ETQIIGGREAVPHSRPYMASLQKAKSHVCGGVLVHRKWVLTAAHCL 69

  Fly    68 QYP-----------DSYSVR-AGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTL 120
            ..|           :.:.:: .|.||        .:...|.||.:| ...|||:||||||:....
Mouse    70 SEPLQNLKLVLGLHNLHDLQDPGLTF--------YIREAIKHPGYN-HKYENDLALLKLDRRVQP 125

  Fly   121 GGNIQVVKLPLPSLNILPRT-------LLVAGWGNPDATDSESEPRLRGTV---VKVINQRLC-- 173
            ..|::.:.||..     ||:       ...||||    ...:..||.|...   ::|::.::|  
Mouse   126 SKNVKPLALPRK-----PRSKPAEGTWCSTAGWG----MTHQGGPRARALQELDLRVLDTQMCNN 181

  Fly   174 QRLYSHLHRPITDDMVC--AAGAGRDHCYGDSGAPLV-HRGSSYGIVSF-AHGCADPHFPGVYTR 234
            .|.::.:   :.|.|:|  |....:..|.||||.||| .:|...||:|| :..|.|...|.|.|.
Mouse   182 SRFWNGV---LIDSMLCLKAGSKSQAPCKGDSGGPLVCGKGQVDGILSFSSKTCTDIFKPPVATA 243

  Fly   235 LANYVTWIFNVL 246
            :|.|.:||..|:
Mouse   244 VAPYSSWIRKVI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 71/245 (29%)
Tryp_SPc 25..242 CDD:238113 71/244 (29%)
GzmmNP_032530.1 Tryp_SPc 27..254 CDD:238113 73/247 (30%)
Tryp_SPc 27..251 CDD:214473 71/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R11227
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.