DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and Klkb1

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_032481.2 Gene:Klkb1 / 16621 MGIID:102849 Length:638 Species:Mus musculus


Alignment Length:252 Identity:79/252 - (31%)
Similarity:112/252 - (44%) Gaps:34/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CGHKTSALSPQERIVGGVEVPIHLTPWLASI---TVHGNYSCSSALITSLWLVTAGHC---VQYP 70
            |..|.:|     |||||....:...||..|:   .|...:.|..::|...|::||.||   :.||
Mouse   383 CTTKINA-----RIVGGTNASLGEWPWQVSLQVKLVSQTHLCGGSIIGRQWVLTAAHCFDGIPYP 442

  Fly    71 DSYSVRAG----STFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLP- 130
            |.:.:..|    |..|......| :..:|:|.::.:.....||||:||....    |....:.| 
Mouse   443 DVWRIYGGILSLSEITKETPSSR-IKELIIHQEYKVSEGNYDIALIKLQTPL----NYTEFQKPI 502

  Fly   131 -LPS---LNILPRTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCA 191
             |||   .|.:.....|.|||. .....|::..|:...:.::....||:.|...  .|...|:||
Mouse   503 CLPSKADTNTIYTNCWVTGWGY-TKEQGETQNILQKATIPLVPNEECQKKYRDY--VINKQMICA 564

  Fly   192 A--GAGRDHCYGDSGAPLV--HRG--SSYGIVSFAHGCADPHFPGVYTRLANYVTWI 242
            .  ..|.|.|.||||.|||  |.|  ...||.|:..|||....|||||:::.|:.||
Mouse   565 GYKEGGTDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKDQPGVYTKVSEYMDWI 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 74/238 (31%)
Tryp_SPc 25..242 CDD:238113 73/237 (31%)
Klkb1NP_032481.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 74/238 (31%)
Tryp_SPc 391..621 CDD:238113 73/237 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.