DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and PRSS36

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:281 Identity:88/281 - (31%)
Similarity:128/281 - (45%) Gaps:41/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILALILLLIC----GHKTSALSPQE---------------RIVGGVEVPIHLTPWLASITVHGNY 48
            :|.|::|:|.    ..:.|||||.:               |||||........||..|:...|.:
Human     6 LLPLVMLVISPIPGAFQDSALSPTQEEPEDLDCGRPEPSARIVGGSNAQPGTWPWQVSLHHGGGH 70

  Fly    49 SCSSALITSLWLVTAGHC------VQYPDSYSVRAGSTFTDG---GGQRRNVVSVILHPDFNLRT 104
            .|..:||...|:::|.||      ::....:||..|....||   |...|.|.::::..:::...
Human    71 ICGGSLIAPSWVLSAAHCFMTNGTLEPAAEWSVLLGVHSQDGPLDGAHTRAVAAIVVPANYSQVE 135

  Fly   105 LENDIALLKLDKSFTLGGNIQVVKLPLPSLNILPRTLLVA-GWGNPDATDSESEP-RLRGTVVKV 167
            |..|:|||:|....:||..:..|.||..|...:..|...| |||:....|....| .|:...:::
Human   136 LGADLALLRLASPASLGPAVWPVCLPRASHRFVHGTACWATGWGDVQEADPLPLPWVLQEVELRL 200

  Fly   168 INQRLCQRLYS-----HLHRPITDDMVCAA--GAGRDHCYGDSGAPLV-HRGSSY---GIVSFAH 221
            :.:..||.|||     :|...|...|:||.  ...||.|.||||.||| ..|..:   ||.||..
Human   201 LGEATCQCLYSQPGPFNLTLQILPGMLCAGYPEGRRDTCQGDSGGPLVCEEGGRWFQAGITSFGF 265

  Fly   222 GCADPHFPGVYTRLANYVTWI 242
            ||...:.|||:|.:|.|..||
Human   266 GCGRRNRPGVFTAVATYEAWI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 77/239 (32%)
Tryp_SPc 25..242 CDD:238113 76/238 (32%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 77/239 (32%)
Tryp_SPc 47..289 CDD:238113 78/240 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.