DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CLIPB14

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_309876.4 Gene:CLIPB14 / 1271130 VectorBaseID:AGAP010833 Length:375 Species:Anopheles gambiae


Alignment Length:296 Identity:75/296 - (25%)
Similarity:121/296 - (40%) Gaps:87/296 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CGHKTSALSPQERIVGGVEVPIHLTPWLASI-------TVHGNYSCSSALITSLWLVTAGHCVQY 69
            ||.....:    ||:||.:..:...||:|.:       .:|||  |.::|::..::::|.||...
Mosquito    92 CGPSVFGV----RIIGGNDTELGEFPWMALLRFQARNRKIHGN--CGASLVSKRFVLSAAHCFTA 150

  Fly    70 PDS-----YSVRAGS-TFTDGGGQR----------------RNVVSVILHPDF--NLRTLENDIA 110
            ..|     :|||... .|.:..|.:                .:|...:.||::  |.....|||.
Mosquito   151 AKSKGWKIHSVRVAEWNFMNHRGSKDCKQVKGYDVPICRKDYDVARFVQHPEYRVNAGVHVNDIV 215

  Fly   111 LLKL--DKSFTLGGNIQVVKLPLPSLNILPR-----------TLLVAGWGNPDATDSESEP---- 158
            |::|  |..:    |:.|..:.||..|...:           ....||||   :|:|..|.    
Mosquito   216 LIELAADVEY----NVFVAPICLPVSNDTAQLPWGSSDDPEIEYTAAGWG---STESGKESTGMS 273

  Fly   159 -RLRGTVVKVINQRLCQRLY----------SHLHRPITDDMVCAAG-AGRDHCYGDSGAPLVHR- 210
             :|:...::..|:..|::|:          .|         :||.| ...|.|:||||.||:.. 
Mosquito   274 YQLKQINLRAFNKERCKKLFQVPSGVGVGLGH---------ICAGGIRDEDTCHGDSGGPLMEAV 329

  Fly   211 -GSSY--GIVSFA-HGCADPHFPGVYTRLANYVTWI 242
             |..|  ||.||. ..|.....|||||.:::|:.|:
Mosquito   330 GGVWYLAGITSFGWPRCGRDGVPGVYTNISHYMGWL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 72/282 (26%)
Tryp_SPc 25..242 CDD:238113 71/281 (25%)
CLIPB14XP_309876.4 CLIP 30..83 CDD:314844
Tryp_SPc 101..367 CDD:238113 72/283 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.