DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and CMA1

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001827.1 Gene:CMA1 / 1215 HGNCID:2097 Length:247 Species:Homo sapiens


Alignment Length:261 Identity:83/261 - (31%)
Similarity:124/261 - (47%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LALILLLICGHKTSALSPQERIVGGVEVPIHLTPWLA---SITVHG-NYSCSSALITSLWLVTAG 64
            |.|:|.|:|....:.     .|:||.|...|..|::|   .:|.:| :..|...||...:::||.
Human     6 LPLLLFLLCSRAEAG-----EIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAA 65

  Fly    65 HCVQYPDSYSVRAGS---TFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQV 126
            ||.  ..|.:|..|:   |..:...|:..|:....||.:|..||.:||.||||.:..:|  .:.|
Human    66 HCA--GRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASL--TLAV 126

  Fly   127 VKLPLPS-LNILP--RTLLVAGWGN----PDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPI 184
            ..||.|| .|.:|  |...|||||.    ...:|:..|.:||     :::.:.|    ||. |..
Human   127 GTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLR-----LMDPQAC----SHF-RDF 181

  Fly   185 TDDMVCAAGAGR---DHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIFNVL 246
            ..::....|..|   ....||||.||:..|.:.||||:....|.|  |.|:||:::|..||..:|
Human   182 DHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKP--PAVFTRISHYRPWINQIL 244

  Fly   247 E 247
            :
Human   245 Q 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 75/234 (32%)
Tryp_SPc 25..242 CDD:238113 75/233 (32%)
CMA1NP_001827.1 Tryp_SPc 22..243 CDD:238113 77/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.