DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and LOC110439067

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_021329153.1 Gene:LOC110439067 / 110439067 -ID:- Length:284 Species:Danio rerio


Alignment Length:266 Identity:87/266 - (32%)
Similarity:127/266 - (47%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNILALILLLICGHKTSALSP------QERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLW 59
            |.|:.:.|||:.     :|.|      ...|..|.|...|..|::.|:..:..:.|...|||..:
Zfish    34 MTIIIISLLLLV-----SLVPDLTYTAHVGIEDGTEAKPHSRPYMVSLQKNSRHICGGFLITEQF 93

  Fly    60 LVTAGHCVQYPDSYSVRAGSTFTDGGG--QRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGG 122
            ::||.||.:..|..:|..|:....|..  ....|.|.|.||::.|.:..|||.||||:|...|..
Zfish    94 VLTAAHCWKKGDVITVGVGAHDLSGNEIYDTFEVTSYIPHPEYKLNSDRNDIMLLKLNKKVRLSH 158

  Fly   123 NIQVVKLPLPSLNILPRTLL-VAGWG-------NPDATDSESEPRLRGTVVKVINQRLCQRLYSH 179
            |:.::.||....::...||. |||||       .||        |||.....::|...|:|.:::
Zfish   159 NVGLMSLPKDGEDVKADTLCSVAGWGRLWLKGPRPD--------RLRKAETVIVNDAECERRWNN 215

  Fly   180 LHRPITDDMVCAAGAGRDHCYGDSGAPLVHRGSSYGIVSFA--HGCADPHFPGVYTRLANYVTWI 242
            .::  ...|:||.|.| ..|.||||.|||...::.||.||.  :.|....||.||||::.|:.||
Zfish   216 TYK--ASKMICAYGHG-GTCSGDSGGPLVCNNTAVGITSFGDRYLCNSRLFPNVYTRISAYLLWI 277

  Fly   243 FNVLEN 248
            .|:..|
Zfish   278 HNITGN 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 76/229 (33%)
Tryp_SPc 25..242 CDD:238113 76/228 (33%)
LOC110439067XP_021329153.1 Tryp_SPc 59..280 CDD:238113 78/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D526726at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.