DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and LOC110439064

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_021329150.1 Gene:LOC110439064 / 110439064 -ID:- Length:240 Species:Danio rerio


Alignment Length:249 Identity:80/249 - (32%)
Similarity:118/249 - (47%) Gaps:22/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNILALILLLICG---HKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVT 62
            |.|:.:.|||:..   |.|  .:.:..||.|.|...|..|::.||.::..:.|...|||..:::|
Zfish     1 MTIIIISLLLLVSLVPHLT--FTARVGIVNGKEAKPHSRPYMVSIQLNEKHICGGFLITEEFVLT 63

  Fly    63 AGHCVQYPDSYSVRAGS-----TFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGG 122
            |.||.:..:..:|..|:     |.|   .:|..|...|.|||:  ||..|:|.:||:||...|..
Zfish    64 AAHCRKKKEEQTVVVGAHDLSKTRT---LKRYGVKFYIPHPDY--RTNRNNIMILKIDKKVKLNN 123

  Fly   123 NIQVVKLPLPSLNI-LPRTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITD 186
            .|:.:.||....:| ......|||||:.......|: ||....|...:.:.|...:...:  :..
Zfish   124 KIKPISLPSDGKHIKAGADCSVAGWGDLWMEGPLSD-RLMEANVTTKSDKYCHVKWGSKY--VAK 185

  Fly   187 DMVCAAGAGRDHCYGDSGAPLVHRGSSYGIVSF--AHGCADPHFPGVYTRLANY 238
            .|:|..|.| ..|.||||.|||...::.|:.||  |..|..|..|.||||::.|
Zfish   186 HMICVYGQG-GSCKGDSGGPLVCGNTAVGVTSFGDARVCDSPEQPEVYTRISAY 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 73/223 (33%)
Tryp_SPc 25..242 CDD:238113 73/222 (33%)
LOC110439064XP_021329150.1 Tryp_SPc 26..239 CDD:238113 73/222 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D526726at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.