DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and gzma

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_012808240.1 Gene:gzma / 100135014 XenbaseID:XB-GENE-482759 Length:267 Species:Xenopus tropicalis


Alignment Length:252 Identity:85/252 - (33%)
Similarity:122/252 - (48%) Gaps:15/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ILALILLLICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCV 67
            :|:.|||||  |....:...  |:.|.|...|..|::|.|..... ||...||...|::||.|||
 Frog    17 LLSSILLLI--HINGNICMD--IIDGREAASHSRPYMAYIYSRTG-SCGGTLIKQNWVLTAAHCV 76

  Fly    68 QYPDSYSVRAGSTFT-DGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPL 131
            .......:.|....: :...||.:|...|.||.|..:...:||.||::..:..|...:.|:|||.
 Frog    77 VNNSEVILGAHKVKSRENEQQRFSVARAIPHPCFEWKKKIHDIQLLQIKGAAKLNKFVSVLKLPT 141

  Fly   132 PSLNILP-RTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCAAGAG 195
            ..:::.| .:...||||............||...|.|:::..|.::|......|:.:|:| |||.
 Frog   142 TDMDVKPGSSCSTAGWGVTKPNGKTPSDVLREVNVTVVDRGTCNKIYKKFKTEISTNMLC-AGAP 205

  Fly   196 R------DHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRL-ANYVTWIFNV 245
            :      |.|.||||.||:......|||||...|.||.:||:|||| |.|:.||.:|
 Frog   206 KKSDKKYDACQGDSGGPLICGKEFSGIVSFGKKCGDPKYPGIYTRLTARYLQWIRDV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 75/226 (33%)
Tryp_SPc 25..242 CDD:238113 75/225 (33%)
gzmaXP_012808240.1 Tryp_SPc 35..262 CDD:238113 77/228 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 136 1.000 Domainoid score I4883
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H136035
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.