DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16998 and gzm3.4

DIOPT Version :9

Sequence 1:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001108167.1 Gene:gzm3.4 / 100001210 ZFINID:ZDB-GENE-070912-136 Length:251 Species:Danio rerio


Alignment Length:254 Identity:72/254 - (28%)
Similarity:117/254 - (46%) Gaps:24/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NILALILLLICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHC 66
            |.:.:||:.....||..:  :..||||.||.:|..|::||:.|...::|...||...:::|:.||
Zfish     4 NNICIILISYSVIKTGGM--ESGIVGGREVKLHSRPYMASLQVQRKHNCGGILIKEDYVLTSAHC 66

  Fly    67 VQYPDSYSVRAGSTFTDGGGQRRN------VVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQ 125
            .:...:..|..|:   ....||.|      |...|.||::..:....||.||||.....|...:.
Zfish    67 WKDTTNLEVVLGA---HNISQRENSQQIIQVQKYIKHPNYQKKNHSFDIMLLKLKTKAVLNHFVN 128

  Fly   126 VVKLPLPSLNIL-PRTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPI---TD 186
            :..||....:|| |....:||||.....:..|      .|::.:|.:|....|......:   :.
Zfish   129 ITNLPKHEPSILAPVECSIAGWGMQRPGEGAS------NVLREVNLQLESNSYCKSKWQVYFNSK 187

  Fly   187 DMVCAAGAGRD-HCYGDSGAPLVHRGSSYGIVSFAH--GCADPHFPGVYTRLANYVTWI 242
            :|||.|..|:. .|.||||:||......||:.::.:  .|....:|.||.:::.::.||
Zfish   188 NMVCTASDGKKAFCQGDSGSPLFCNSELYGMAAYTYPNNCTFKEYPEVYMKVSAFLPWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 65/230 (28%)
Tryp_SPc 25..242 CDD:238113 65/229 (28%)
gzm3.4NP_001108167.1 Tryp_SPc 25..249 CDD:238113 67/231 (29%)
Tryp_SPc 25..246 CDD:214473 65/229 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.