DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lqf and ENT4

DIOPT Version :9

Sequence 1:NP_729266.2 Gene:lqf / 38846 FlyBaseID:FBgn0028582 Length:831 Species:Drosophila melanogaster
Sequence 2:NP_013062.1 Gene:ENT4 / 850621 SGDID:S000003961 Length:247 Species:Saccharomyces cerevisiae


Alignment Length:219 Identity:56/219 - (25%)
Similarity:102/219 - (46%) Gaps:28/219 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SDAQVKVREATSNDPW-GPSAAIMSEIAELTYNVVAFSEIMQMIWKRL-------NDHGKNWRHV 83
            |..:.||::||:.|.. |.:..:|:||:.|||:.....||:|:|.|||       |.| :|...|
Yeast    13 SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSH-RNCIQV 76

  Fly    84 YKALILLEYLIKTGSEKVAQQCKENIFAIQTLREFVYFEEGKDQ--GTHVREKAKQLVTLLKDDE 146
            .|.|.|:.||:..||.:..:..|.|:..|:.|.:| ..::.:|:  ...:::.::.::.||:||.
Yeast    77 MKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDF-QVQDPRDERKAEDIQKLSRNVLGLLQDDG 140

  Fly   147 RLKNERVKAQKAKERFAQNPSGFGSDGYIDGPSQRDLPPGWQE----------EPPKSVSELEMV 201
            .|:.:|....:.:...: .|....:|.     |...|.....|          :||.:.:.|:..
Yeast   141 LLEKQRKDVIQFRSSIS-TPGRKSTDN-----SHLKLEEMRSELTRQSLEKKAKPPTTSTSLDFQ 199

  Fly   202 RPQTAGEEELQLQLAMAMSREEAE 225
            |.:|....|........::.|::|
Yeast   200 RQRTRNTHEYARFSLDPLAEEDSE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lqfNP_729266.2 ENTH_epsin 28..149 CDD:239627 40/130 (31%)
UIM 208..227 CDD:197845 3/18 (17%)
ENT4NP_013062.1 ENTH_Ent4 15..132 CDD:340791 36/118 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2056
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1984
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.