DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lqf and MYCBPAP

DIOPT Version :9

Sequence 1:NP_729266.2 Gene:lqf / 38846 FlyBaseID:FBgn0028582 Length:831 Species:Drosophila melanogaster
Sequence 2:XP_016880694.1 Gene:MYCBPAP / 84073 HGNCID:19677 Length:1011 Species:Homo sapiens


Alignment Length:279 Identity:64/279 - (22%)
Similarity:96/279 - (34%) Gaps:90/279 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 LKDDERLK---------NERVKAQKAKERFAQNPSGFGSDGYIDGPSQRDLPPGWQEEPPKSVSE 197
            ||.|.||:         :|.||.:|..:                ||.|.  .|..||||      
Human    47 LKKDSRLRITPTRLLEASENVKEKKRAK----------------GPEQP--TPTIQEEP------ 87

  Fly   198 LEMVRPQTAGEEELQLQLAMAMSREEAEQEEAKR--RSDDVRLQLALSQSEQDF-------KDPN 253
             |.|.....|::    .||:|:.:|:.:::...|  ..:|.|:      ..|.|       .||.
Human    88 -EPVSNVLQGDD----ILALAIKKEDLKEQHIPRLTEKEDKRV------ITQKFIIRKLKPMDPR 141

  Fly   254 GRP---IPAPKKEEQQSHLLDLLDISLGATSISSPPLGAAGGAPTAVVDPWAMPGPRAPSQLSDP 315
            .:.   :..|...::.:..||.    .|..|:|          |...|  :.:.||      .|.
Human   142 RKVCHLVARPANPDEATKPLDY----SGTPSLS----------PGFTV--FQLMGP------GDS 184

  Fly   316 WSGTSSPQVDPWNPSAAPRTILGAGVPMTSAPLGAGNDAWGAR-TQSPSVASGSSNEGWLQSNGN 379
            :.|  |.|:       .|..|||:........|..||.....| ..||.:.:..|.||  :|...
Human   185 FDG--SDQI-------LPHHILGSLQDFKRIALARGNTQLAERIPTSPCLMTLISAEG--ESKQK 238

  Fly   380 ANQNGRGATPAGPPAEGWL 398
            |.:..:....|.||...:|
Human   239 APKEEKRPPWAPPPQHNFL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lqfNP_729266.2 ENTH_epsin 28..149 CDD:239627 4/6 (67%)
UIM 208..227 CDD:197845 4/18 (22%)
MYCBPAPXP_016880694.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143858
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.