DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lqf and AT1G08670

DIOPT Version :9

Sequence 1:NP_729266.2 Gene:lqf / 38846 FlyBaseID:FBgn0028582 Length:831 Species:Drosophila melanogaster
Sequence 2:NP_172343.2 Gene:AT1G08670 / 837389 AraportID:AT1G08670 Length:231 Species:Arabidopsis thaliana


Alignment Length:167 Identity:40/167 - (23%)
Similarity:82/167 - (49%) Gaps:10/167 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LRRNIKNLAHNYSDA---QVKVREATSNDPWGPSAAIMSEIAELTYNVVAFSEIMQMIWKRL--N 74
            ::..||......:|.   ::...|.|.:|.....:..|:.|..:::.|..|..|::::.:|:  .
plant    21 IKEKIKTARLAVTDVTAEELLTEEVTGSDHSSIDSRSMAAITRVSFEVDQFQRIVKILRQRMVVF 85

  Fly    75 DHGKNWRHVYKALILLEYLIKTGSEKVAQQCKENIFAIQTLREFVYFEE-GKDQGTHVREKAKQL 138
            |. |.||.:...|.:|.:|:..|...|..:.:.....|:...:..:.:| |.|.|..||..|:::
plant    86 DR-KEWRGMCNTLSMLNHLLLNGPLSVFSEFQHERAIIEDAIKMEWIDERGFDCGLKVRNIAEKV 149

  Fly   139 VTLLKDDERLKNERVKAQKAKERFAQNPSGFGSDGYI 175
            :.||:||..||:||   ::.:::.....:|||:..::
plant   150 LRLLEDDMFLKDER---ERNRKQSIGRITGFGNSSFV 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lqfNP_729266.2 ENTH_epsin 28..149 CDD:239627 31/126 (25%)
UIM 208..227 CDD:197845
AT1G08670NP_172343.2 ENTH 35..159 CDD:396137 30/124 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2056
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.