DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lqf and Clint1

DIOPT Version :10

Sequence 1:NP_729266.2 Gene:lqf / 38846 FlyBaseID:FBgn0028582 Length:831 Species:Drosophila melanogaster
Sequence 2:NP_001333689.1 Gene:Clint1 / 216705 MGIID:2144243 Length:641 Species:Mus musculus


Alignment Length:72 Identity:18/72 - (25%)
Similarity:33/72 - (45%) Gaps:13/72 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 FVLLLSR--LNKHDAHLLSSP------QVMEARALWMKELQNQTHSSKESRDMILEEED--ITPS 303
            ||..:|:  ||.:..:|..:|      |.:...|::.:..|..|.|...|   :.|..:  ::.|
Mouse    58 FVFDMSKWDLNNNTCNLCKNPFMQNEKQKLPVSAVYWRASQKCTMSLSSS---VYESSESLVSSS 119

  Fly   304 TSNYYNH 310
            ||:..|:
Mouse   120 TSSIENN 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lqfNP_729266.2 ENTH_Epsin 28..150 CDD:340787
UIM 208..227 CDD:197845
PHA03247 <278..394 CDD:223021 9/35 (26%)
Clint1NP_001333689.1 ENTH_EpsinR 24..149 CDD:340786 18/72 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.