DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lqf and mycbpap

DIOPT Version :9

Sequence 1:NP_729266.2 Gene:lqf / 38846 FlyBaseID:FBgn0028582 Length:831 Species:Drosophila melanogaster
Sequence 2:XP_001345218.5 Gene:mycbpap / 100006494 ZFINID:ZDB-GENE-080923-1 Length:783 Species:Danio rerio


Alignment Length:154 Identity:40/154 - (25%)
Similarity:57/154 - (37%) Gaps:38/154 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 VYFEEGKDQGT-------HVREKAKQLVTLLKDDERLKNERVKAQKAKERFAQNPSGFGSDGYID 176
            ||.|.|:..|:       |..::...:...|...||.....:      .|.||..|.....|.:.
Zfish   249 VYTEHGRRVGSEFWSVPQHYGDEMSGITATLTQTERGNPAEL------TRIAQPISTRLETGDVQ 307

  Fly   177 GPSQRDLPPGWQEE--PPKSVSEL-EMVR----PQTAGEEELQLQLAMAMS-----REEAEQEEA 229
            |.:...:   ||:.  ..:...|| :|:|    |...|.|.|...|.:..|     |:|.|:||.
Zfish   308 GDAVNSV---WQQSLYLQQRRRELKDMLRDFSPPDVDGLEVLGCGLPVPPSPLLDERQEKEEEEQ 369

  Fly   230 KRRSD----------DVRLQLALS 243
            |...|          ||.|:.|||
Zfish   370 KENQDPLAQFDDIIMDVELRPALS 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lqfNP_729266.2 ENTH_epsin 28..149 CDD:239627 9/36 (25%)
UIM 208..227 CDD:197845 7/23 (30%)
mycbpapXP_001345218.5 MYCBPAP 191..590 CDD:291319 40/154 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576791
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.