DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ltl and lrrc3ca

DIOPT Version :10

Sequence 1:NP_729265.1 Gene:ltl / 38845 FlyBaseID:FBgn0268063 Length:817 Species:Drosophila melanogaster
Sequence 2:XP_005156157.1 Gene:lrrc3ca / 571711 ZFINID:ZDB-GENE-080327-9 Length:266 Species:Danio rerio


Alignment Length:181 Identity:41/181 - (22%)
Similarity:69/181 - (38%) Gaps:45/181 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 GDFDG-MIRLDILDLTG----------------NQLAELKPLEMTLLPSLKILKVAYNNITKLEQ 455
            |.||| .:|...|.||.                |.|..:.......||.|..|.:::|.::.||.
Zfish    47 GSFDGKTMRCSNLHLTEIPQDIPNDTRRLYLDYNLLTSIPANAFHDLPLLAELDLSHNELSLLEP 111

  Fly   456 D-FKGLPV-LCQANLTNNQISTISSELVTNTRCKNHNVPGKLEIHLDDNPIMCDVGLNE------ 512
            . |:||.. |...:|::||:.|:..:...:.|.::         :|..||..||..|..      
Zfish   112 GAFRGLTASLKFLDLSSNQLKTLDPDAFDSVRARS---------NLTGNPWHCDCRLQTALPRLD 167

  Fly   513 ---------LCRLMAVQEARIRGRSQCFENDQEVCTVLPMLYNVNLPIMVT 554
                     :|:.....:|..:|.......|.::|.||..  ..::.::||
Zfish   168 LEPVSLTGIVCQTFEPSDAGAQGVPFLLAKDLDLCVVLKK--TTDVAMLVT 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ltlNP_729265.1 LRR 65..476 CDD:443914 24/86 (28%)
leucine-rich repeat 65..86 CDD:275380
leucine-rich repeat 87..110 CDD:275380
leucine-rich repeat 111..134 CDD:275380
leucine-rich repeat 135..158 CDD:275380
leucine-rich repeat 159..180 CDD:275380
leucine-rich repeat 181..203 CDD:275380
leucine-rich repeat 204..226 CDD:275380
leucine-rich repeat 227..249 CDD:275380
leucine-rich repeat 250..272 CDD:275380
leucine-rich repeat 273..296 CDD:275380
leucine-rich repeat 297..315 CDD:275380
leucine-rich repeat 320..335 CDD:275378
leucine-rich repeat 344..366 CDD:275380
leucine-rich repeat 367..391 CDD:275380
leucine-rich repeat 392..415 CDD:275380 4/7 (57%)
leucine-rich repeat 416..439 CDD:275380 6/38 (16%)
leucine-rich repeat 440..462 CDD:275380 8/22 (36%)
leucine-rich repeat 463..483 CDD:275380 5/19 (26%)
lrrc3caXP_005156157.1 leucine-rich repeat 52..71 CDD:275378 4/18 (22%)
PRK15370 <53..>176 CDD:185268 28/131 (21%)
leucine-rich repeat 72..95 CDD:275378 3/22 (14%)
LRR_8 73..131 CDD:404697 15/57 (26%)
leucine-rich repeat 96..120 CDD:275378 8/23 (35%)
leucine-rich repeat 121..144 CDD:275378 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.