DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ltl and LOC5666886

DIOPT Version :10

Sequence 1:NP_729265.1 Gene:ltl / 38845 FlyBaseID:FBgn0268063 Length:817 Species:Drosophila melanogaster
Sequence 2:XP_001687922.2 Gene:LOC5666886 / 5666886 VectorBaseID:AGAMI1_008635 Length:542 Species:Anopheles gambiae


Alignment Length:222 Identity:53/222 - (23%)
Similarity:87/222 - (39%) Gaps:56/222 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 GQLRLLMAHNNRLERLP-ANMAGMHSLETVHIHCNQLRSFDRVLRNAVNLSEVMADNNELEYLAQ 288
            |.|..|.|.||.:..|. |::...|.|.::.:..|:|.|.....::...|..:..:.|.||.:|.
Mosquito   104 GNLEQLSARNNSIRALDFASIGVEHRLRSLRLDDNELSSVPLFGKSFNELKYLSLEGNRLEEVAL 168

  Fly   289 DEFASCSKVETLQMGCNHIKSLNSSL----------LPILKLKNANFSFNDIEEFSMAELHGLRS 343
            |.|....::::|.:..|.:..:.|:.          :.:||||:                     
Mosquito   169 DSFTGLGQLQSLSLARNGLIVVESTTRAPARSIHQGVQLLKLKH--------------------- 212

  Fly   344 LKTLQLSSNRIQRLLPDPRGVQELMLVNLDLDNN----RIDSLNGALAGLGNLRILNLAGN---- 400
               |.|:|||:  :..:..|.:...||:|||.||    .:|..: .|...|.|..::.|||    
Mosquito   213 ---LSLASNRL--ITVNISGWEMPSLVSLDLSNNDLYLLLDEAH-QLGQFGALLEVSYAGNDWQC 271

  Fly   401 ----------RLEHLQVGDFDGMIRLD 417
                      |...:.|.|.|...|.|
Mosquito   272 SWLSEAQLMLRKRGIAVKDQDPAARCD 298

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ltlNP_729265.1 LRR 65..476 CDD:443914 53/222 (24%)
leucine-rich repeat 65..86 CDD:275380
leucine-rich repeat 87..110 CDD:275380
leucine-rich repeat 111..134 CDD:275380
leucine-rich repeat 135..158 CDD:275380
leucine-rich repeat 159..180 CDD:275380
leucine-rich repeat 181..203 CDD:275380