DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ltl and chp

DIOPT Version :9

Sequence 1:NP_001261524.1 Gene:ltl / 38845 FlyBaseID:FBgn0268063 Length:817 Species:Drosophila melanogaster
Sequence 2:NP_001263137.1 Gene:chp / 43690 FlyBaseID:FBgn0267435 Length:1338 Species:Drosophila melanogaster


Alignment Length:664 Identity:152/664 - (22%)
Similarity:234/664 - (35%) Gaps:223/664 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PCTCETGKAWNHVELSCEK-------LESFNAVVDSLANKLNADTNIDLKITHSQLDDLEMRSFT 81
            |||       .:|..:|.|       :...|....:|...:|......|.:.::.|.::|  .:.
  Fly    43 PCT-------YNVMCTCSKSSTDLGIVHCKNVPFPALPRMVNQSKVFMLHMENTGLREIE--PYF 98

  Fly    82 DMNFNLYKLRMQWNSLKSLPEVPFRGLSNVTY-LSIGDNDLDEIPKHALSHMPSLLTLDIGRCKI 145
            ..:..:|:|::..|.|..:|:..|.||....: |.:..|||.|||..:|.|:..|..||:|...|
  Fly    99 LQSTGMYRLKISGNHLTEIPDDAFTGLERSLWELILPQNDLVEIPSKSLRHLQKLRHLDLGYNHI 163

  Fly   146 RAVQQEDFRGIQ-RVTNLILVSNIITRLDRGSFPKSLLILHLGRNQLESLNGSLHDLHNLESLFI 209
            ..:|.:.|||:: .:..|||..|.|::|...|| ..|||                    ||:|.:
  Fly   164 THIQHDSFRGLEDSLQTLILRENCISQLMSHSF-SGLLI--------------------LETLDL 207

  Fly   210 NANNITSLDDELPDGGQLRL--LMAHNNRLERLP------------------------------- 241
            :.||:..:|..:...|..||  |:..:|.|..:|                               
  Fly   208 SGNNLFEIDPNVFVDGMPRLTRLLLTDNILSEIPYDALGPLKSLRTLDISHNVIWSLSGNETYEI 272

  Fly   242 -----ANMAGMHSLETVHIHC---NQLRSFDRVLR-----------------------------N 269
                 .|:..:| ||..||..   |..:.||.|.|                             .
  Fly   273 KASTKLNLDNLH-LEYNHIEVLPPNSFKYFDTVNRTFFDGNPIHTLREDAFKPARIREIYMRYCG 336

  Fly   270 AVNLSEVMADN------------NELEYLAQDEFASCSKVETLQMGCNHI--------------- 307
            ..|:|.|..|:            |.|..|....|.:...:..:.|..|.|               
  Fly   337 LTNISPVAFDSLVNSLQILDLSGNNLTKLHHKLFNNFDVLRVISMRDNKIKIQKPTETFNAVHYT 401

  Fly   308 --------------------KSLNSSLLPILKLKNANFSFNDIEEFSM---------AELHGL-- 341
                                |..|...|.|.:|.:::....|.::|.:         |.|.|:  
  Fly   402 LLKLDLSGDRNDPTNLQTLRKMRNMRSLSISRLGSSSVGPEDFKDFGVELEDLQITRASLSGIQS 466

  Fly   342 ------RSLKTLQLSSNRIQRL-------------------------LP-DPRGVQEL-MLVNLD 373
                  |.||.|..|.|.|..:                         || :|  ::.| .|..||
  Fly   467 HAFKHVRGLKRLDFSENGISSIENDAFHEIGHSLISLKMSHGYSGSALPAEP--LRHLTSLQELD 529

  Fly   374 LDNNRIDSLNG-ALAGLGNLRILNLAGNRLEHLQVGDFDGMI--RLDILDLTGNQLAELKPLEMT 435
            ..||.|.|::. :...|.|||:|.|..||:|.:..|.|.|.|  :|:.:.|..|.|..:......
  Fly   530 FSNNHISSMSDTSFHFLKNLRLLELHDNRIEQVLKGTFQGDIHSKLEEISLRFNHLTSISQHTFF 594

  Fly   436 LLPSLKILKVAYNNITKLE-QDFKGLPVLCQANLTNNQISTISSELVTNTRCKNHNVPGKLEIHL 499
            .|.:|:.|.:..|.|.|:| :.|..|..|...:|..|:|:.::.|       ...|:| ||||  
  Fly   595 DLEALRKLHLDDNKIDKIERRAFMNLDELEYLSLRGNKINNLADE-------SFQNLP-KLEI-- 649

  Fly   500 DDNPIMCDVGLNEL 513
                  .|:..|:|
  Fly   650 ------LDMAFNQL 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ltlNP_001261524.1 leucine-rich repeat 65..86 CDD:275380 3/20 (15%)
LRR_8 86..145 CDD:290566 21/59 (36%)
leucine-rich repeat 87..110 CDD:275380 8/22 (36%)
leucine-rich repeat 111..134 CDD:275380 9/23 (39%)
leucine-rich repeat 135..158 CDD:275380 9/23 (39%)
LRR_8 158..214 CDD:290566 15/55 (27%)
leucine-rich repeat 159..180 CDD:275380 8/20 (40%)
leucine-rich repeat 181..203 CDD:275380 3/21 (14%)
leucine-rich repeat 204..226 CDD:275380 6/21 (29%)
LRR_RI 226..451 CDD:238064 77/388 (20%)
leucine-rich repeat 227..249 CDD:275380 7/59 (12%)
leucine-rich repeat 250..272 CDD:275380 9/53 (17%)
leucine-rich repeat 273..296 CDD:275380 7/34 (21%)
leucine-rich repeat 297..315 CDD:275380 5/52 (10%)
LRR_8 319..402 CDD:290566 31/127 (24%)
leucine-rich repeat 320..335 CDD:275378 3/14 (21%)
leucine-rich repeat 344..366 CDD:275380 9/47 (19%)
leucine-rich repeat 367..391 CDD:275380 9/25 (36%)
LRR_8 369..426 CDD:290566 23/59 (39%)
leucine-rich repeat 392..415 CDD:275380 11/24 (46%)
leucine-rich repeat 416..439 CDD:275380 5/22 (23%)
LRR_8 438..>479 CDD:290566 12/41 (29%)
leucine-rich repeat 440..462 CDD:275380 8/22 (36%)
leucine-rich repeat 463..483 CDD:275380 5/19 (26%)
chpNP_001263137.1 leucine-rich repeat 84..103 CDD:275380 3/20 (15%)
LRR_8 102..163 CDD:290566 21/60 (35%)
leucine-rich repeat 104..128 CDD:275380 8/23 (35%)
LRR_RI <128..261 CDD:238064 42/153 (27%)
leucine-rich repeat 129..152 CDD:275380 9/22 (41%)
LRR_8 152..212 CDD:290566 24/80 (30%)
leucine-rich repeat 153..177 CDD:275380 9/23 (39%)
leucine-rich repeat 178..201 CDD:275380 9/23 (39%)
LRR_8 202..261 CDD:290566 13/58 (22%)
leucine-rich repeat 202..226 CDD:275380 7/23 (30%)
leucine-rich repeat 227..250 CDD:275380 5/22 (23%)
leucine-rich repeat 251..279 CDD:275380 0/27 (0%)
leucine-rich repeat 280..326 CDD:275380 10/46 (22%)
LRR_8 326..386 CDD:290566 10/59 (17%)
leucine-rich repeat 327..348 CDD:275380 4/20 (20%)
leucine-rich repeat 352..375 CDD:275380 4/22 (18%)
leucine-rich repeat 376..401 CDD:275380 3/24 (13%)
leucine-rich repeat 426..450 CDD:275378 5/23 (22%)
LRR_RI <448..651 CDD:238064 58/220 (26%)
leucine-rich repeat 451..474 CDD:275380 3/22 (14%)
LRR_8 473..559 CDD:290566 25/87 (29%)
leucine-rich repeat 475..524 CDD:275380 10/50 (20%)
leucine-rich repeat 500..519 CDD:275380 3/20 (15%)
leucine-rich repeat 525..548 CDD:275380 8/22 (36%)
leucine-rich repeat 549..574 CDD:275380 11/24 (46%)
LRR_8 573..633 CDD:290566 16/59 (27%)
leucine-rich repeat 575..598 CDD:275380 5/22 (23%)
leucine-rich repeat 599..622 CDD:275380 8/22 (36%)
LRR_8 622..683 CDD:290566 14/52 (27%)
leucine-rich repeat 623..646 CDD:275380 7/30 (23%)
leucine-rich repeat 647..730 CDD:275380 6/19 (32%)
leucine-rich repeat 648..673 CDD:275380 5/18 (28%)
leucine-rich repeat 674..705 CDD:275380
LRR_8 704..763 CDD:290566
leucine-rich repeat 731..754 CDD:275380
LRR_8 753..813 CDD:290566
leucine-rich repeat 755..778 CDD:275380
leucine-rich repeat 779..802 CDD:275380
leucine-rich repeat 803..823 CDD:275380
leucine-rich repeat 852..876 CDD:275380
LRR_8 854..910 CDD:290566
LRR_RI <877..>1006 CDD:238064
leucine-rich repeat 877..900 CDD:275380
leucine-rich repeat 901..925 CDD:275380
leucine-rich repeat 926..946 CDD:275380
LRR_8 947..1004 CDD:290566
leucine-rich repeat 947..970 CDD:275380
leucine-rich repeat 971..993 CDD:275380
LRR_8 992..1049 CDD:290566
leucine-rich repeat 994..1014 CDD:275380
leucine-rich repeat 1019..1042 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453810
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.