DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ltl and caps

DIOPT Version :9

Sequence 1:NP_001261524.1 Gene:ltl / 38845 FlyBaseID:FBgn0268063 Length:817 Species:Drosophila melanogaster
Sequence 2:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster


Alignment Length:847 Identity:170/847 - (20%)
Similarity:289/847 - (34%) Gaps:254/847 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LANKLNA----DTNIDLKITHSQLDDLEMRSFTDMNFNLYKLRMQWNSLKSLPEVPFRGLSNVTY 113
            |||..|.    |..:.:......||.|.:.    :|..:.:|.::.|.||:: :...:..:.:|:
  Fly    40 LANCPNGCECDDDTLMVNCGEGTLDVLPIA----LNPAIQRLVIKNNKLKTI-DSSMQFYAQLTF 99

  Fly   114 LSIGDNDLDEIPKHALSHMPSLLTLDIGRCKIRAVQQEDFRGIQRVTNLILVSNIITRLDRGSFP 178
            |.:..||:..||:.:.::...|..|.:...||..|..:.|.|:..::.|.|..|:|..|:..:|.
  Fly   100 LDLSFNDMLTIPERSFAYHAKLQELHLDHNKIGQVSNKTFLGLSTISVLNLRGNLIAELEYRTFS 164

  Fly   179 K--SLLILHLGRNQLESLN-GSLHDLHNLESLFINANNITSLDDELPDGGQLRLLMAHNNRLERL 240
            .  .|..|:||:|::..:: .:|..|.||..|:::.|.:|::..||                   
  Fly   165 PMVKLAELNLGQNRISHIDPHALDGLDNLRVLYLDDNTLTTVPGEL------------------- 210

  Fly   241 PANMAGMHSLETVHIHCNQLRSFDRVLRNAVNLSEVMADNNELEYLAQDEFASCSKVETLQMGCN 305
              ....:|||..:::..|   ||..:...|.                ||                
  Fly   211 --TFQALHSLAELYLGTN---SFMTIPGGAF----------------QD---------------- 238

  Fly   306 HIKSLNSSLLPILKLKNANFSFNDIEEFSMAELHGLRSLKTLQLSSNRIQRLLPDPRGVQEL-ML 369
             :|.|..     |.|:.|.     :...|...|.||.||:.|.||.||:..:  .....|.| .|
  Fly   239 -LKGLTR-----LDLRGAG-----LHNISGDALKGLVSLRFLDLSDNRLPAI--PTAAFQRLGRL 290

  Fly   370 VNLDLDNNRIDSL-NGALAGLGNLRILNLAG-NRLEHLQVGDFDGMIRLDILDLTGN-QLAELKP 431
            ..|::..|..:.: :||.:||..||.|.|.| .||..::.|.|.|...|:.|:|:.| ||.||..
  Fly   291 EQLNIGQNDFEVISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTNLEHLNLSSNKQLNELSS 355

  Fly   432 LEMTLLPSLKILKVAYNNITKLEQDFKGLPVLCQANLTNNQISTISSELVTNTRCKNHNVPGKLE 496
            :.:                       .|||.|....|..||:|::...||.....:.        
  Fly   356 IAL-----------------------GGLPHLSTVVLKANQLSSLDEGLVPWADLQT-------- 389

  Fly   497 IHLDDNPIMCDVGLNELCRLMAVQEARIRGRSQCFENDQEVCTVLPMLYNVNLPIMVTNLKLTGR 561
            :.|.:||..||      |||:.::...: .|:...:....:|.         .|..:.:|.|.  
  Fly   390 LDLSENPFECD------CRLLWLRHLLV-SRNASGQYAPVICA---------YPTALRDLPLA-- 436

  Fly   562 EVPKPMV---------RVIVPSLIKANNELLPPLIATL--------------------------- 590
            .:.:|::         :.|:..|:.|...|:..|...|                           
  Fly   437 HLAEPLLGCAHGAASKQAIIGILVVACAALITTLALVLYTCRHRIREMLKGHSALGRKEREYQKT 501

  Fly   591 ----------------------GNPVLISTDLVNPV----ISPLPPPLLL-------ATTTPPPP 622
                                  |.|.:.....:.||    :...|||.|.       |:|.....
  Fly   502 FSDEEYMSRPPPGGGGVHPAAGGYPYIAGNSRMIPVTELXLEAPPPPQLRGRGGGGGASTASGAV 566

  Fly   623 LPLPVESEVEKNESTTANPVPTNYTQETTTTTSTTTTTTTTETSSQVAPIEIITTTA--PTTTTT 685
            ..|.|.|.|::..::.|.....:|..............:|::.......:.::....  |...|:
  Fly   567 QQLQVPSAVDQASNSFAQLSHIHYMTNNGQQQQAQQQQSTSKMHHSQQDMRLLACNGGKPLNATS 631

  Fly   686 STTTPKPNETLPVIVELQDPNPPDTTVNQTALVPPVVLDPLQQDLERERERERERELERDLDHEA 750
                 .|....||:.|        :|::..:       .||...:...::.....:.:....|  
  Fly   632 -----LPRHRPPVVQE--------STLSHYS-------QPLANGIRLTQDHFNHNQNQSHNQH-- 674

  Fly   751 VAKTEYETVEYIPNLVQPPVGSDALTPPPSKANALEEDSESVHSNSVHAEYP--HAAQSLQIPEE 813
                 |..|...|        .||::.|           ..:|:|| |...|  |.......|..
  Fly   675 -----YGGVYAKP--------CDAMSEP-----------GYIHNNS-HYSLPLDHDLPPSPTPTP 714

  Fly   814 PP 815
            ||
  Fly   715 PP 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ltlNP_001261524.1 leucine-rich repeat 65..86 CDD:275380 4/20 (20%)
LRR_8 86..145 CDD:290566 12/58 (21%)
leucine-rich repeat 87..110 CDD:275380 4/22 (18%)
leucine-rich repeat 111..134 CDD:275380 6/22 (27%)
leucine-rich repeat 135..158 CDD:275380 7/22 (32%)
LRR_8 158..214 CDD:290566 17/58 (29%)
leucine-rich repeat 159..180 CDD:275380 6/22 (27%)
leucine-rich repeat 181..203 CDD:275380 7/22 (32%)
leucine-rich repeat 204..226 CDD:275380 6/21 (29%)
LRR_RI 226..451 CDD:238064 52/228 (23%)
leucine-rich repeat 227..249 CDD:275380 0/21 (0%)
leucine-rich repeat 250..272 CDD:275380 5/21 (24%)
leucine-rich repeat 273..296 CDD:275380 2/22 (9%)
leucine-rich repeat 297..315 CDD:275380 2/17 (12%)
LRR_8 319..402 CDD:290566 27/85 (32%)
leucine-rich repeat 320..335 CDD:275378 2/14 (14%)
leucine-rich repeat 344..366 CDD:275380 6/21 (29%)
leucine-rich repeat 367..391 CDD:275380 8/25 (32%)
LRR_8 369..426 CDD:290566 21/59 (36%)
leucine-rich repeat 392..415 CDD:275380 10/23 (43%)
leucine-rich repeat 416..439 CDD:275380 8/23 (35%)
LRR_8 438..>479 CDD:290566 8/40 (20%)
leucine-rich repeat 440..462 CDD:275380 2/21 (10%)
leucine-rich repeat 463..483 CDD:275380 7/19 (37%)
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 4/21 (19%)
LRR_8 96..155 CDD:290566 16/58 (28%)
leucine-rich repeat 97..120 CDD:275380 6/22 (27%)
leucine-rich repeat 121..144 CDD:275380 7/22 (32%)
LRR_8 143..201 CDD:290566 16/57 (28%)
leucine-rich repeat 145..168 CDD:275380 6/22 (27%)
LRR_RI 147..397 CDD:238064 84/349 (24%)
leucine-rich repeat 169..192 CDD:275380 7/22 (32%)
leucine-rich repeat 193..217 CDD:275380 6/44 (14%)
LRR_8 217..276 CDD:290566 23/104 (22%)
leucine-rich repeat 218..241 CDD:275380 7/58 (12%)
leucine-rich repeat 242..265 CDD:275380 8/32 (25%)
LRR_8 265..321 CDD:290566 20/57 (35%)
leucine-rich repeat 266..289 CDD:275380 8/24 (33%)
leucine-rich repeat 290..313 CDD:275380 7/22 (32%)
LRR_8 312..374 CDD:290566 24/84 (29%)
leucine-rich repeat 314..335 CDD:275380 9/20 (45%)
leucine-rich repeat 339..363 CDD:275380 10/46 (22%)
LRRCT 395..445 CDD:214507 13/67 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.