DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ltl and trn

DIOPT Version :9

Sequence 1:NP_001261524.1 Gene:ltl / 38845 FlyBaseID:FBgn0268063 Length:817 Species:Drosophila melanogaster
Sequence 2:NP_001261796.1 Gene:trn / 39491 FlyBaseID:FBgn0010452 Length:751 Species:Drosophila melanogaster


Alignment Length:848 Identity:179/848 - (21%)
Similarity:295/848 - (34%) Gaps:246/848 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LASLQCSVRPEISPCTCETGKAWNHVELSCEKLESFNAVVDSLANKLNADTNIDLKITHSQLDDL 75
            |||:  .|.|......|..|       ..|:                  |..:.::....|||.|
  Fly    16 LASI--GVEPAAGLANCPPG-------CQCD------------------DNTLVVQCGEGQLDVL 53

  Fly    76 EMRSFTDMNFNLYKLRMQWNSLKSLPEVPFRGLSNVTYLSIGDNDLDEIPKHALSHMPSLLTLDI 140
            .:.    :|.::.:|.::.|.:|:: :...:..:.:|:|.:..|.|..||:...::...|..:.:
  Fly    54 PIA----LNPSIQRLVIKSNKIKTI-DSSIQFYAELTFLDLSSNHLMTIPQRTFAYQKKLQEVHL 113

  Fly   141 GRCKIRAVQQEDFRGIQRVTNLILVSNIITRLDRGSFPKSLLILHLGRNQLESLNGSLHDLHNLE 205
            ...||..:..:.|.|:..||.|.|..|.|:.|.:|:|...|        ::|.||          
  Fly   114 NHNKIGQISNKTFIGLSAVTVLNLRGNQISELHQGTFTPLL--------KIEELN---------- 160

  Fly   206 SLFINANNITSLDDELPDG-GQLRLLMAHNNRLERLPANMAGMHSLETVHIHCNQLRSFDRVLRN 269
               :..|.|..||.:..|| .|||:|...:|.|..:|                      |.|:..
  Fly   161 ---LGENRIGYLDPKAFDGLSQLRILYLDDNALTTVP----------------------DPVIFQ 200

  Fly   270 AV-NLSEVMADNNELEYLAQDEFASCSKVETLQMGCNHIKSLNSSLLPILKLKNANFSFNDIEEF 333
            |: :|:|:....|.|:.:..|.|             ..:|.|..     |:||.|:     :...
  Fly   201 AMPSLAELFLGMNTLQSIQADAF-------------QDLKGLTR-----LELKGAS-----LRNI 242

  Fly   334 SMAELHGLRSLKTLQLSSNRIQRLLPDPR-GVQELM-LVNLDLDNNRIDSLN-GALAGLGNLRIL 395
            |.....||:.|:.|.||.||:.|:   |. |:.:|: |..|.|..|..:.:: ||..||..|:.|
  Fly   243 SHDSFLGLQELRILDLSDNRLDRI---PSVGLSKLVRLEQLSLGQNDFEVISEGAFMGLKQLKRL 304

  Fly   396 NLAGN-RLEHLQVGDFDGMIRLDILDLTGNQ-LAELKPLEMTLLPSLKILKVAYNNITKLEQ--- 455
            .:.|. ||:.:..|.|.....|:.|:|:.|: |.|::...::.|..||.:.:..|.:|.|.:   
  Fly   305 EVNGALRLKRVMTGAFSDNGNLEYLNLSSNKMLLEVQEGALSGLSQLKHVVLKANALTSLAEGLF 369

  Fly   456 DFKGLPVLCQANLTNNQISTISSELVTNTRCKNHNVPGKLEIHLDDNPIMCDVGLNELCRLMAVQ 520
            .:|.|..|                                  .|.:||:.||      ||:|.:.
  Fly   370 PWKDLQTL----------------------------------DLSENPLSCD------CRVMWLH 394

  Fly   521 EARIRGRSQCFENDQEVCTVLPMLYNVNLPIMVTNLKLTGREVPKPMVRVIVPSLIKANNELLPP 585
            ...:...:...:..:.:|.....|...:|..:  |..:.|.....|..:.::.:|:..:...:..
  Fly   395 NLLVAKNASQDDVSELLCEFPERLRGESLRHL--NPAMMGCTHADPRKQALIGALLVGSAATITA 457

  Fly   586 LIATL----------------GNPVL----------------------------ISTDLVNPVIS 606
            |...|                ||..|                            |.:...|...:
  Fly   458 LALVLYRCRHKIRETIKGGLWGNSALGRKEREYQKTFCDEDYMSRHQHHPCSLGIHSTFPNTYTA 522

  Fly   607 PLPPPLLLATTTPPPPLPLPVESEVEKNESTTANPVPTNYTQETTTTTSTTTTTTTTETSSQVAP 671
            |..|    ..|......|:||      |:....:  |....|:....|:|..:......:..:..
  Fly   523 PHHP----GATHHYGMCPMPV------NDLGAID--PQQKFQQLVVPTATMISEKKLNNNKALVS 575

  Fly   672 IEIITTTAPTTTTTSTTTPKPNETLPVIVELQDPN----------PPDTTVNQT----ALVPPVV 722
            ...|..:|      |......:.|:...|..|:|.          ....||..:    |.||.|.
  Fly   576 QGAIDDSA------SFVLHMKSATMGRDVHQQNPQLNHYTKPQFLSATATVGDSCYSYADVPMVH 634

  Fly   723 LDPL----QQDLEREREREREREL------ERDLDHEAVAKTEYETVEYIPNLVQPPVG-SDALT 776
            ..||    |..|...:|..::|||      ...|||..:    |....|...|.|  :| |...|
  Fly   635 GAPLGGPNQPQLRLTQEHFKQRELYDQEMGSEILDHNYI----YSNTHYSMPLEQ--LGRSKTPT 693

  Fly   777 PPP 779
            |||
  Fly   694 PPP 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ltlNP_001261524.1 leucine-rich repeat 65..86 CDD:275380 5/20 (25%)
LRR_8 86..145 CDD:290566 10/58 (17%)
leucine-rich repeat 87..110 CDD:275380 3/22 (14%)
leucine-rich repeat 111..134 CDD:275380 6/22 (27%)
leucine-rich repeat 135..158 CDD:275380 5/22 (23%)
LRR_8 158..214 CDD:290566 14/55 (25%)
leucine-rich repeat 159..180 CDD:275380 9/20 (45%)
leucine-rich repeat 181..203 CDD:275380 4/21 (19%)
leucine-rich repeat 204..226 CDD:275380 6/22 (27%)
LRR_RI 226..451 CDD:238064 60/230 (26%)
leucine-rich repeat 227..249 CDD:275380 6/21 (29%)
leucine-rich repeat 250..272 CDD:275380 3/22 (14%)
leucine-rich repeat 273..296 CDD:275380 6/22 (27%)
leucine-rich repeat 297..315 CDD:275380 2/17 (12%)
LRR_8 319..402 CDD:290566 27/86 (31%)
leucine-rich repeat 320..335 CDD:275378 3/14 (21%)
leucine-rich repeat 344..366 CDD:275380 9/22 (41%)
leucine-rich repeat 367..391 CDD:275380 9/25 (36%)
LRR_8 369..426 CDD:290566 19/59 (32%)
leucine-rich repeat 392..415 CDD:275380 7/23 (30%)
leucine-rich repeat 416..439 CDD:275380 7/23 (30%)
LRR_8 438..>479 CDD:290566 8/43 (19%)
leucine-rich repeat 440..462 CDD:275380 7/24 (29%)
leucine-rich repeat 463..483 CDD:275380 1/19 (5%)
trnNP_001261796.1 leucine-rich repeat 62..80 CDD:275380 3/18 (17%)
LRR_8 83..142 CDD:290566 16/58 (28%)
leucine-rich repeat 84..107 CDD:275380 6/22 (27%)
leucine-rich repeat 108..131 CDD:275380 5/22 (23%)
LRR_RI 129..421 CDD:238064 94/400 (24%)
LRR_8 132..190 CDD:290566 24/78 (31%)
leucine-rich repeat 132..155 CDD:275380 10/30 (33%)
leucine-rich repeat 156..179 CDD:275380 9/35 (26%)
leucine-rich repeat 180..204 CDD:275380 9/45 (20%)
LRR_8 203..263 CDD:290566 20/82 (24%)
leucine-rich repeat 205..228 CDD:275380 6/35 (17%)
leucine-rich repeat 229..252 CDD:275380 8/32 (25%)
LRR_8 252..308 CDD:290566 20/58 (34%)
leucine-rich repeat 253..276 CDD:275380 10/25 (40%)
leucine-rich repeat 277..300 CDD:275380 8/22 (36%)
leucine-rich repeat 301..322 CDD:275380 7/20 (35%)
LRR_8 325..384 CDD:290566 17/92 (18%)
leucine-rich repeat 326..350 CDD:275380 7/23 (30%)
leucine-rich repeat 351..373 CDD:275380 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453590
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.