DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ltl and CG42709

DIOPT Version :9

Sequence 1:NP_001261524.1 Gene:ltl / 38845 FlyBaseID:FBgn0268063 Length:817 Species:Drosophila melanogaster
Sequence 2:NP_001163434.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster


Alignment Length:509 Identity:98/509 - (19%)
Similarity:159/509 - (31%) Gaps:167/509 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 NQLESLNGSLHDLHNLESLFINANNITSLDDELPDGGQLRLLMAHNNR--------LERLPANMA 245
            |.||..|....|...           |:..:|.|:..:.||:...::.        :..:|..  
  Fly    33 NPLEDFNYGDDDYSE-----------TATGEESPETAENRLMPQSSSTSTTTTFRPIFNIPRR-- 84

  Fly   246 GMHSLE-TVHIHCNQLRSFDRVLRNAVNLSEVMAD-----------NNELEYLAQDEFASCSKVE 298
            ..|.|| :...:|..|..|..|.....:|:.|..|           :|.:..|..::||:.|:..
  Fly    85 SNHVLEPSCPRNCLCLEDFKFVQCANAHLTHVPLDMPKTAAIIDLSHNVIAELRPEDFANLSRAV 149

  Fly   299 TLQMGCNHIKSLNSSLLPILKLKNANFSFNDIEEFSMAELHGLRSLKTLQLSSNRIQRLLPDP-R 362
            .:.:..|.|.|::..:                       ..|...||.|:|::||:.::.||. .
  Fly   150 EINLNHNLISSIDKDV-----------------------FQGSERLKRLRLANNRLTKIDPDTFA 191

  Fly   363 GVQELMLVNLDLDNNRI-DSLNGALAGLGNLRILNLAGNRLEHLQVGDFDGMIRLDILDLTGNQL 426
            ..:||.|  |||.||.| ..|:|:.....:|...:........|....|..|..|::|.|..|..
  Fly   192 AAKELTL--LDLSNNTITQRLDGSFLNQPDLVEFSCVNCSWTELPEQTFQNMSGLEVLRLNKNDF 254

  Fly   427 AELKPLEMTLLPSLKILKVAYNNITKLEQDFKGLPVLCQANLTNNQISTISSELVTNTRCKNHNV 491
            .:            :|...|::.:||:.:  ..||.|.|.|                        
  Fly   255 KQ------------QINTKAFSPLTKIIK--LKLPELEQQN------------------------ 281

  Fly   492 PGKLEIHLDDNPIMCDVGLNELCRLMAVQEARIRGRSQCFENDQEVCTVLPMLYNVNLPIMVTNL 556
                              :.|||.|:.                 .:.|:..:.|:::....|...
  Fly   282 ------------------IEELCSLLT-----------------SIDTISFLNYDISCYEFVLGT 311

  Fly   557 KLTGREVPKPMVRVIVPSLIKANNELLPPLIATLGNPVLIS-TDLVNPVISPLPPPLLLATTTPP 620
            ...|             |||....   |||......|::.| |....||           |.||.
  Fly   312 PFNG-------------SLIYPTE---PPLKGITNPPIVASITSTAKPV-----------TATPA 349

  Fly   621 PPLPLPVESEVEKNESTTANPVPTNYTQETTTTTSTTTTTTTTETSSQVAPIEI 674
            ||      ....:|.....|..........::.|||:..:......||...::|
  Fly   350 PP------RSANRNRGKMDNSTELVKAGILSSETSTSGVSVEPPAESQTNQVQI 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ltlNP_001261524.1 leucine-rich repeat 65..86 CDD:275380
LRR_8 86..145 CDD:290566
leucine-rich repeat 87..110 CDD:275380
leucine-rich repeat 111..134 CDD:275380
leucine-rich repeat 135..158 CDD:275380
LRR_8 158..214 CDD:290566 5/24 (21%)
leucine-rich repeat 159..180 CDD:275380
leucine-rich repeat 181..203 CDD:275380 5/13 (38%)
leucine-rich repeat 204..226 CDD:275380 3/21 (14%)
LRR_RI 226..451 CDD:238064 51/246 (21%)
leucine-rich repeat 227..249 CDD:275380 3/29 (10%)
leucine-rich repeat 250..272 CDD:275380 6/22 (27%)
leucine-rich repeat 273..296 CDD:275380 7/33 (21%)
leucine-rich repeat 297..315 CDD:275380 3/17 (18%)
LRR_8 319..402 CDD:290566 21/84 (25%)
leucine-rich repeat 320..335 CDD:275378 0/14 (0%)
leucine-rich repeat 344..366 CDD:275380 8/22 (36%)
leucine-rich repeat 367..391 CDD:275380 10/24 (42%)
LRR_8 369..426 CDD:290566 17/57 (30%)
leucine-rich repeat 392..415 CDD:275380 4/22 (18%)
leucine-rich repeat 416..439 CDD:275380 4/22 (18%)
LRR_8 438..>479 CDD:290566 9/40 (23%)
leucine-rich repeat 440..462 CDD:275380 5/21 (24%)
leucine-rich repeat 463..483 CDD:275380 3/19 (16%)
CG42709NP_001163434.1 LRR_8 126..182 CDD:290566 14/78 (18%)
leucine-rich repeat 128..147 CDD:275380 4/18 (22%)
leucine-rich repeat 148..171 CDD:275380 4/45 (9%)
LRR_RI <150..225 CDD:238064 24/99 (24%)
LRR_8 171..254 CDD:290566 27/84 (32%)
leucine-rich repeat 172..195 CDD:275380 8/22 (36%)
leucine-rich repeat 196..219 CDD:275380 10/24 (42%)
leucine-rich repeat 220..243 CDD:275380 4/22 (18%)
leucine-rich repeat 244..268 CDD:275380 6/35 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453776
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.