DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ltl and CG16974

DIOPT Version :9

Sequence 1:NP_001261524.1 Gene:ltl / 38845 FlyBaseID:FBgn0268063 Length:817 Species:Drosophila melanogaster
Sequence 2:NP_001246018.1 Gene:CG16974 / 34713 FlyBaseID:FBgn0032479 Length:1257 Species:Drosophila melanogaster


Alignment Length:705 Identity:157/705 - (22%)
Similarity:285/705 - (40%) Gaps:106/705 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SLVYTVFHLASLQCSVRPEISPCTCETGKAW--------NHVELSCEKLESFNAVVDSLAN--KL 57
            ||:...|||..:..:|..::.....:.| .|        ..||:...:|.|... ||...|  ||
  Fly    66 SLLGYKFHLPFVGHAVDSDLDDSDSDEG-LWLDAADAGSESVEVEEHELPSVGH-VDPTGNVFKL 128

  Fly    58 NADTNIDLKITHSQLDDLEMRSFTDMNFNLYKLRM----QWNSLKSLPEVPFRGLSNVTYLSIGD 118
            |.: ::||:..:.:|  |..|| :.:|:|...|..    :.|.|| ||:     |.::...|...
  Fly   129 NCE-HVDLRRVNQEL--LSQRS-SHINYNQLMLAHVPADRSNPLK-LPQ-----LESLREFSWQS 183

  Fly   119 NDL-DEIPKHALSHMPS----LLTLDIGRCKIRAVQQEDFRGIQRVTNLILVSNIITRLDRGS-- 176
            ::| ||......:..|.    :..|::...::..:.......::||..|.:..|   ||...|  
  Fly   184 SELKDETLMELFTRQPRSFEYMERLNLAENRLECLHWAIPLAVRRVKVLEMSGN---RLSNCSLL 245

  Fly   177 ---FPKSLLILHLGRNQLESL-NGSLHDLHNLESLFINANNITSLDDELPDGG-QLRLLMAHNNR 236
               :.|.|..|||.|::|..| ...|.:|..|..|.::.|.:|.|..::..|. :|..|....||
  Fly   246 NLQYMKQLQELHLDRSELTYLPQRFLGELSELRMLNLSQNLLTELPRDIFVGALKLERLYLSGNR 310

  Fly   237 LERLPANM-AGMHSLETVHIHCNQLRSF-DRVLRNAVNLSEVMADNNELEYLAQDEFASCSKVET 299
            |..||..: .....|:.:.:..|:|.|| |........|.::....|:|:.:.:....|..::..
  Fly   311 LSVLPFMLFQTAADLQVLDLSDNRLLSFPDNFFARNGQLRQLHLQRNQLKSIGKHSLYSLRELRQ 375

  Fly   300 LQMGCNHIKSLN----SSLLPILKLKNANFSFNDIEEFSMAELHGLRSLKTLQLSSNRIQRLLPD 360
            |.:..|.:..::    .||..:|.|   |.|.|::...|......|.:|:.|.||.|:.::|   
  Fly   376 LDLSQNSLSVIDRKAFESLDHLLAL---NVSGNNLTLLSSIIFQSLHALRQLDLSRNQFKQL--- 434

  Fly   361 PRGV--QELMLVNLDLDNNRIDSLNGALA----GLGNLRILNLAGNRLEHLQVGDFDGMIRLDIL 419
            |.|:  ::..||.|.:|...|:..:..::    .|.:.::|    :||.:|.|            
  Fly   435 PSGLFQRQRSLVLLRIDETPIEQFSNWISRYDESLVDPQVL----HRLRYLSV------------ 483

  Fly   420 DLTGNQLAELKPLEMTLL---PSLKILKVAYNNITKLEQDFKGLPVLCQANLTNNQISTISSELV 481
                .|..:|..|..||.   |:::.|.:|.|.:.:|.....||..|.:.::..|.:.::...:.
  Fly   484 ----QQNRKLTYLPATLFANTPNIRELLLAENGLLQLPTQISGLSRLQRLSVRGNSLGSLPENIK 544

  Fly   482 TNTRCKNHNVPGKLEIHLDDNPIMCDVGLNELCRLMAVQEARIR---GRSQCFENDQEVCTVLPM 543
            ...:....|:.|        |...||..:..|...:|.....:|   .::|...|.....|.|..
  Fly   545 ELRQLHYLNILG--------NEYQCDCSMYWLTAWLANTSTSLRHQMPQAQNHSNGSTNQTPLDS 601

  Fly   544 LYNVNLPIMVTNLKLTGREVPKPMVRVI------VPSLIKANNELLPPLIATLGNPVLISTDLVN 602
            ..:::..|.....:...|   ..|:||:      ||::::.:...:..|::|......||...|.
  Fly   602 YESIDHQIDALKCQYGYR---GDMLRVLSKLNCSVPTVVQFSEPKMHKLLSTAKLECQISGSPVP 663

  Fly   603 PVISPLPPPLLLATTTPPPPLPLPVESEVEKNESTTANPVPT----NYTQETTTT 653
            .:|...|...:|.....|...|:.::|:.:.::..:|..:..    :|.|....|
  Fly   664 DIIWVTPRNKILRHHADPDKRPIIIDSKEDAHQPPSAQELAALMDESYIQSLNWT 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ltlNP_001261524.1 leucine-rich repeat 65..86 CDD:275380 6/20 (30%)
LRR_8 86..145 CDD:290566 14/67 (21%)
leucine-rich repeat 87..110 CDD:275380 7/26 (27%)
leucine-rich repeat 111..134 CDD:275380 4/23 (17%)
leucine-rich repeat 135..158 CDD:275380 1/22 (5%)
LRR_8 158..214 CDD:290566 20/61 (33%)
leucine-rich repeat 159..180 CDD:275380 6/25 (24%)
leucine-rich repeat 181..203 CDD:275380 9/22 (41%)
leucine-rich repeat 204..226 CDD:275380 6/22 (27%)
LRR_RI 226..451 CDD:238064 56/239 (23%)
leucine-rich repeat 227..249 CDD:275380 7/22 (32%)
leucine-rich repeat 250..272 CDD:275380 6/22 (27%)
leucine-rich repeat 273..296 CDD:275380 4/22 (18%)
leucine-rich repeat 297..315 CDD:275380 3/21 (14%)
LRR_8 319..402 CDD:290566 21/88 (24%)
leucine-rich repeat 320..335 CDD:275378 4/14 (29%)
leucine-rich repeat 344..366 CDD:275380 8/23 (35%)
leucine-rich repeat 367..391 CDD:275380 6/27 (22%)
LRR_8 369..426 CDD:290566 11/60 (18%)
leucine-rich repeat 392..415 CDD:275380 5/22 (23%)
leucine-rich repeat 416..439 CDD:275380 5/25 (20%)
LRR_8 438..>479 CDD:290566 9/40 (23%)
leucine-rich repeat 440..462 CDD:275380 6/21 (29%)
leucine-rich repeat 463..483 CDD:275380 2/19 (11%)
CG16974NP_001246018.1 leucine-rich repeat 206..228 CDD:275380 1/21 (5%)
leucine-rich repeat 229..252 CDD:275380 6/25 (24%)
LRR_RI <246..433 CDD:238064 49/189 (26%)
LRR_8 251..311 CDD:290566 19/59 (32%)
leucine-rich repeat 253..276 CDD:275380 9/22 (41%)
leucine-rich repeat 277..300 CDD:275380 6/22 (27%)
leucine-rich repeat 301..324 CDD:275380 7/22 (32%)
LRR_8 325..383 CDD:290566 12/57 (21%)
leucine-rich repeat 325..348 CDD:275380 6/22 (27%)
leucine-rich repeat 349..372 CDD:275380 4/22 (18%)
LRR_RI 351..>557 CDD:238064 49/239 (21%)
LRR_8 371..431 CDD:290566 16/62 (26%)
leucine-rich repeat 373..396 CDD:275380 4/22 (18%)
leucine-rich repeat 397..420 CDD:275380 7/25 (28%)
leucine-rich repeat 421..444 CDD:275380 8/25 (32%)
LRR_8 477..536 CDD:290566 18/74 (24%)
leucine-rich repeat 478..502 CDD:275380 8/39 (21%)
leucine-rich repeat 503..526 CDD:275380 6/22 (27%)
Ig <714..761 CDD:299845 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453818
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.